diff --git a/0001-Remove-legacy-overlay-solution-leftovers.patch b/0001-Remove-legacy-overlay-solution-leftovers.patch new file mode 100644 index 0000000..4f8c3aa --- /dev/null +++ b/0001-Remove-legacy-overlay-solution-leftovers.patch @@ -0,0 +1,112 @@ +From 34aeae1e023e61345a1bb020b42231a79a0be4a8 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Thu, 26 Feb 2026 17:52:23 +0100 +Subject: [PATCH 01/44] Remove legacy overlay solution leftovers + +The solution was removed in 93429, however there are some leftovers. +--- + .../libraries/userspacegen.py | 19 ------------------- + .../common/libraries/dnfplugin.py | 15 ++++----------- + .../common/libraries/overlaygen.py | 6 ------ + 3 files changed, 4 insertions(+), 36 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py b/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py +index 66843645..7dbadae2 100644 +--- a/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py ++++ b/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py +@@ -178,26 +178,7 @@ def _import_gpg_keys(context, install_root_dir, target_major_version): + ) + + +-def _handle_transaction_err_msg_size_old(err): +- # NOTE(pstodulk): This is going to be removed in future! +- +- article_section = 'Generic case' +- xfs_info = next(api.consume(XFSPresence), XFSPresence()) +- if xfs_info.present and xfs_info.without_ftype: +- article_section = 'XFS ftype=0 case' +- +- message = ('There is not enough space on the file system hosting /var/lib/leapp directory ' +- 'to extract the packages.') +- details = {'hint': "Please follow the instructions in the '{}' section of the article at: " +- "link: https://access.redhat.com/solutions/5057391".format(article_section)} +- +- raise StopActorExecutionError(message=message, details=details) +- +- + def _handle_transaction_err_msg_size(err): +- if get_env('LEAPP_OVL_LEGACY', '0') == '1': +- _handle_transaction_err_msg_size_old(err) +- return # not needed actually as the above function raises error, but for visibility + NO_SPACE_STR = 'more space needed on the' + + # Disk Requirements: +diff --git a/repos/system_upgrade/common/libraries/dnfplugin.py b/repos/system_upgrade/common/libraries/dnfplugin.py +index d50dbbce..b91bcbe7 100644 +--- a/repos/system_upgrade/common/libraries/dnfplugin.py ++++ b/repos/system_upgrade/common/libraries/dnfplugin.py +@@ -7,7 +7,6 @@ import shutil + + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.common import dnfconfig, guards, mounting, overlaygen, rhsm, utils +-from leapp.libraries.common.config import get_env + from leapp.libraries.common.config.version import get_target_major_version, get_target_version + from leapp.libraries.common.gpg import is_nogpgcheck_set + from leapp.libraries.stdlib import api, CalledProcessError, config +@@ -166,16 +165,10 @@ def _handle_transaction_err_msg_old(stage, xfs_info, err): + raise StopActorExecutionError(message=message, details=details) + + +-def _handle_transaction_err_msg(stage, xfs_info, err, is_container=False): +- # ignore the fallback when the error is related to the container issue +- # e.g. installation of packages inside the container; so it's unrelated +- # to the upgrade transactions. +- if get_env('LEAPP_OVL_LEGACY', '0') == '1' and not is_container: +- _handle_transaction_err_msg_old(stage, xfs_info, err) +- return # not needed actually as the above function raises error, but for visibility ++def _handle_transaction_err_msg(err, is_container=False): + NO_SPACE_STR = 'more space needed on the' +- message = 'DNF execution failed with non zero exit code.' + if NO_SPACE_STR not in err.stderr: ++ message = 'DNF execution failed with non zero exit code.' + # if there was a problem reaching repos and proxy is configured in DNF/YUM configs, the + # proxy is likely the problem. + # NOTE(mmatuska): We can't consistently detect there was a problem reaching some repos, +@@ -308,7 +301,7 @@ def _transaction(context, stage, target_repoids, tasks, plugin_info, xfs_info, + ) + except CalledProcessError as e: + api.current_logger().error('Cannot calculate, check, test, or perform the upgrade transaction.') +- _handle_transaction_err_msg(stage, xfs_info, e, is_container=False) ++ _handle_transaction_err_msg(e, is_container=False) + finally: + if stage == 'check': + backup_debug_data(context=context) +@@ -384,7 +377,7 @@ def install_initramdisk_requirements(packages, target_userspace_info, used_repos + api.current_logger().error( + 'Cannot install packages in the target container required to build the upgrade initramfs.' + ) +- _handle_transaction_err_msg('', None, e, is_container=True) ++ _handle_transaction_err_msg(e, is_container=True) + + + def perform_transaction_install(target_userspace_info, storage_info, used_repos, tasks, plugin_info, xfs_info): +diff --git a/repos/system_upgrade/common/libraries/overlaygen.py b/repos/system_upgrade/common/libraries/overlaygen.py +index f0d0ba1d..3091ab5b 100644 +--- a/repos/system_upgrade/common/libraries/overlaygen.py ++++ b/repos/system_upgrade/common/libraries/overlaygen.py +@@ -594,12 +594,6 @@ def create_source_overlay( + in the OVERLAY_DO_NOT_MOUNT set. Such prepared OVL images are then composed + together to reflect the real host filesystem. In the end everything is cleaned. + +- The new solution can be now problematic for system with too many partitions +- and loop devices. For such systems we keep for now the possibility of the +- fallback to an old solution, which has however number of issues that are +- fixed by the new design. To fallback to the old solution, set envar: +- LEAPP_OVL_LEGACY=1 +- + Disk images created for OVL are formatted with XFS by default. In case of + problems, it's possible to switch to Ext4 FS using: + LEAPP_OVL_IMG_FS_EXT4=1 +-- +2.53.0 + diff --git a/0002-update-upgrade-paths-8.10-9.9-10.3.patch b/0002-update-upgrade-paths-8.10-9.9-10.3.patch new file mode 100644 index 0000000..fc20baa --- /dev/null +++ b/0002-update-upgrade-paths-8.10-9.9-10.3.patch @@ -0,0 +1,1053 @@ +From 763077b15bdb019984186034c026ecaefb6de7f9 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Tue, 24 Feb 2026 19:12:00 +0100 +Subject: [PATCH 02/44] update upgrade paths: 8.10 -> 9.9 -> 10.3 + +Introduce new upgrade paths and add them to the CI tests. + +Jira: RHEL-150279 +--- + .packit.yaml | 193 +++++++++++++++--- + .../common/files/prod-certs/10.3/279.pem | 35 ++++ + .../common/files/prod-certs/10.3/362.pem | 36 ++++ + .../common/files/prod-certs/10.3/363.pem | 35 ++++ + .../common/files/prod-certs/10.3/419.pem | 35 ++++ + .../common/files/prod-certs/10.3/433.pem | 35 ++++ + .../common/files/prod-certs/10.3/479.pem | 35 ++++ + .../common/files/prod-certs/10.3/486.pem | 35 ++++ + .../common/files/prod-certs/10.3/72.pem | 35 ++++ + .../common/files/prod-certs/9.9/279.pem | 35 ++++ + .../common/files/prod-certs/9.9/362.pem | 36 ++++ + .../common/files/prod-certs/9.9/363.pem | 35 ++++ + .../common/files/prod-certs/9.9/419.pem | 35 ++++ + .../common/files/prod-certs/9.9/433.pem | 35 ++++ + .../common/files/prod-certs/9.9/479.pem | 35 ++++ + .../common/files/prod-certs/9.9/486.pem | 35 ++++ + .../common/files/prod-certs/9.9/72.pem | 35 ++++ + .../common/files/upgrade_paths.json | 17 +- + 18 files changed, 735 insertions(+), 37 deletions(-) + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/279.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/362.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/363.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/419.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/433.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/479.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/486.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/10.3/72.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/279.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/362.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/363.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/419.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/433.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/479.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/486.pem + create mode 100644 repos/system_upgrade/common/files/prod-certs/9.9/72.pem + +diff --git a/.packit.yaml b/.packit.yaml +index 37fa7849..49e251d8 100644 +--- a/.packit.yaml ++++ b/.packit.yaml +@@ -141,6 +141,15 @@ jobs: + provisioning: + tags: + BusinessUnit: sst_upgrades@leapp_upstream_test ++ - &tmt-env-settings-810to99 ++ tmt: ++ context: &tmt-context-810to99 ++ distro: "rhel-8.10" ++ distro_target: "rhel-9.9" ++ settings: ++ provisioning: ++ tags: ++ BusinessUnit: sst_upgrades@leapp_upstream_test + + - &sanity-abstract-8to9-aws + <<: *sanity-abstract-8to9 +@@ -220,7 +229,7 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true & tag:-rhsm' ++ plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true & tag:-rhsm' + environments: + - *tmt-env-settings-810to96 + env: +@@ -296,14 +305,68 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true' ++ plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true' + environments: + - *tmt-env-settings-810to98 + env: + <<: *env-810to98 + + # ###################################################################### # +-# ############################## 9 TO 10 ################################ # ++# ############################# 8.10 > 9.9 ############################# # ++# ###################################################################### # ++ ++- &sanity-810to99 ++ <<: *sanity-abstract-8to9 ++ trigger: pull_request ++ identifier: sanity-8.10to9.9 ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:8to9 & tag:tier0 & enabled:true' ++ environments: ++ - *tmt-env-settings-810to99 ++ env: &env-810to99 ++ SOURCE_RELEASE: "8.10" ++ TARGET_RELEASE: "9.9" ++ ++# On-demand minimal beaker tests ++- &beaker-minimal-810to99 ++ <<: *beaker-minimal-8to9-abstract-ondemand ++ trigger: pull_request ++ labels: ++ - beaker-minimal ++ - beaker-minimal-8.10to9.9 ++ - 8.10to9.9 ++ identifier: sanity-8.10to9.9-beaker-minimal-ondemand ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:8to9 & tag:partitioning & enabled:true' ++ environments: ++ - *tmt-env-settings-810to99 ++ env: ++ <<: *env-810to99 ++ ++# On-demand kernel-rt tests ++- &kernel-rt-810to99 ++ <<: *kernel-rt-abstract-8to9-ondemand ++ trigger: pull_request ++ labels: ++ - kernel-rt ++ - kernel-rt-8.10to9.9 ++ - 8.10to9.9 ++ identifier: sanity-8.10to9.9-kernel-rt-ondemand ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true' ++ environments: ++ - *tmt-env-settings-810to99 ++ env: ++ <<: *env-810to99 ++ ++# ###################################################################### # ++# ############################## 9 TO 10 ############################### # + # ###################################################################### # + + # ###################################################################### # +@@ -345,15 +408,6 @@ jobs: + provisioning: + tags: + BusinessUnit: sst_upgrades@leapp_upstream_test +- - &tmt-env-settings-centos9torhel101 +- tmt: +- context: &tmt-context-centos9torhel101 +- distro: "centos-9" +- distro_target: "rhel-10.1" +- settings: +- provisioning: +- tags: +- BusinessUnit: sst_upgrades@leapp_upstream_test + - &tmt-env-settings-98to102 + tmt: + context: &tmt-context-98to102 +@@ -372,6 +426,24 @@ jobs: + provisioning: + tags: + BusinessUnit: sst_upgrades@leapp_upstream_test ++ - &tmt-env-settings-99to103 ++ tmt: ++ context: &tmt-context-99to103 ++ distro: "rhel-9.9" ++ distro_target: "rhel-10.3" ++ settings: ++ provisioning: ++ tags: ++ BusinessUnit: sst_upgrades@leapp_upstream_test ++ - &tmt-env-settings-centos9torhel103 ++ tmt: ++ context: &tmt-context-centos9torhel103 ++ distro: "centos-9" ++ distro_target: "rhel-10.3" ++ settings: ++ provisioning: ++ tags: ++ BusinessUnit: sst_upgrades@leapp_upstream_test + + - &sanity-abstract-9to10-aws + <<: *sanity-abstract-9to10 +@@ -439,7 +511,7 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:partitioning & enabled:true & tag:-rhsm' ++ plan_filter: 'tag:9to10 & tag:partitioning & enabled:true & tag:-rhsm' + environments: + - *tmt-env-settings-96to100 + env: +@@ -457,7 +529,7 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true & tag:-rhsm' ++ plan_filter: 'tag:9to10 & tag:kernel-rt & enabled:true & tag:-rhsm' + environments: + - *tmt-env-settings-96to100 + env: +@@ -499,7 +571,7 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:partitioning & enabled:true & tag:-rhsm' ++ plan_filter: 'tag:9to10 & tag:partitioning & enabled:true & tag:-rhsm' + environments: + - *tmt-env-settings-98to102 + env: +@@ -520,12 +592,76 @@ jobs: + tf_extra_params: + test: + tmt: +- plan_filter: 'tag:8to9 & tag:kernel-rt & enabled:true & tag:-rhsm' ++ plan_filter: 'tag:9to10 & tag:kernel-rt & enabled:true & tag:-rhsm' + environments: + - *tmt-env-settings-98to102 + env: + <<: *env-98to102 + ++# ###################################################################### # ++# ############################# 9.9 > 10.3 ############################# # ++# ###################################################################### # ++ ++- &sanity-99to103 ++ <<: *sanity-abstract-9to10 ++ trigger: pull_request ++ identifier: sanity-9.9to10.3 ++ targets: ++ epel-9-x86_64: ++ distros: [RHEL-9.9.0-Nightly] ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:9to10 & tag:tier0 & enabled:true & tag:-rhsm' ++ environments: ++ - *tmt-env-settings-99to103 ++ env: &env-99to103 ++ SOURCE_RELEASE: "9.9" ++ TARGET_RELEASE: "10.3" ++ ++# On-demand minimal beaker tests ++- &beaker-minimal-99to103 ++ <<: *beaker-minimal-9to10-abstract-ondemand ++ trigger: pull_request ++ labels: ++ - beaker-minimal ++ - beaker-minimal-9.9to10.3 ++ - 9.9to10.3 ++ identifier: sanity-9.9to10.3-beaker-minimal-ondemand ++ targets: ++ epel-9-x86_64: ++ distros: [RHEL-9.9-Nightly] ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:9to10 & tag:partitioning & enabled:true & tag:-rhsm' ++ environments: ++ - *tmt-env-settings-99to103 ++ env: ++ <<: *env-99to103 ++ ++# On-demand kernel-rt tests ++- &kernel-rt-99to103 ++ <<: *kernel-rt-abstract-9to10-ondemand ++ trigger: pull_request ++ labels: ++ - kernel-rt ++ - kernel-rt-9.9to10.3 ++ - 9.9to10.3 ++ identifier: sanity-9.9to10.3-kernel-rt-ondemand ++ targets: ++ epel-9-x86_64: ++ distros: [RHEL-9.9-Nightly] ++ tf_extra_params: ++ test: ++ tmt: ++ plan_filter: 'tag:9to10 & tag:kernel-rt & enabled:true & tag:-rhsm' ++ environments: ++ - *tmt-env-settings-99to103 ++ env: ++ <<: *env-99to103 ++ ++ + # ###################################################################### # + # ########################## CentOS Stream ############################# # + # ###################################################################### # +@@ -535,13 +671,13 @@ jobs: + # ###################################################################### # + + # ###################################################################### # +-# ############################ 9 > 10.1 ################################ # ++# ############################ 9 > 10.2 ################################ # + # ###################################################################### # + +-- &sanity-centos9torhel101 ++- &sanity-centos9torhel102 + <<: *sanity-abstract-9to10 + trigger: pull_request +- identifier: sanity-CentOS9toRHEL10.1 ++ identifier: sanity-CentOS9toRHEL10.2 + targets: + epel-9-x86_64: + distros: [CentOS-Stream-9] +@@ -550,19 +686,19 @@ jobs: + tmt: + plan_filter: 'tag:9to10 & tag:tier0 & enabled:true & tag:-rhsm' + environments: +- - *tmt-env-settings-centos9torhel101 +- env: &env-centos9to101 ++ - *tmt-env-settings-centos9torhel102 ++ env: &env-centos9torhel102 + SOURCE_RELEASE: "9" +- TARGET_RELEASE: "10.1" ++ TARGET_RELEASE: "10.2" + + # ###################################################################### # +-# ############################ 9 > 10.2 ################################ # ++# ############################ 9 > 10.3 ################################ # + # ###################################################################### # + +-- &sanity-centos9torhel102 ++- &sanity-centos9torhel103 + <<: *sanity-abstract-9to10 + trigger: pull_request +- identifier: sanity-CentOS9toRHEL10.2 ++ identifier: sanity-CentOS9toRHEL10.3 + targets: + epel-9-x86_64: + distros: [CentOS-Stream-9] +@@ -570,12 +706,11 @@ jobs: + test: + tmt: + plan_filter: 'tag:9to10 & tag:tier0 & enabled:true & tag:-rhsm' +- name: + environments: +- - *tmt-env-settings-centos9torhel102 +- env: &env-centos9torhel102 ++ - *tmt-env-settings-centos9torhel103 ++ env: &env-centos9torhel103 + SOURCE_RELEASE: "9" +- TARGET_RELEASE: "10.2" ++ TARGET_RELEASE: "10.3" + + # ###################################################################### # + # ################## CentOS Stream > CentOS Stream ##################### # +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/279.pem b/repos/system_upgrade/common/files/prod-certs/10.3/279.pem +new file mode 100644 +index 00000000..2c0a1998 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/279.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGKDCCBBCgAwIBAgIJALDxRLt/tVClMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjA0N1oXDTQ2MDEx ++OTE4MjA0N1owRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFs3MWZmZWUx ++Yy1kMjE5LTRiZjgtYTJjYi1lOTM0OTk3ODQ1ZmRdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBsTCBrjAJBgNVHRMEAjAAMEMGDCsGAQQBkggJAYIXAQQzDDFSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIFBvd2VyLCBsaXR0bGUgZW5kaWFuMBYGDCsG ++AQQBkggJAYIXAgQGDAQxMC4zMBkGDCsGAQQBkggJAYIXAwQJDAdwcGM2NGxlMCkG ++DCsGAQQBkggJAYIXBAQZDBdyaGVsLTEwLHJoZWwtMTAtcHBjNjRsZTANBgkqhkiG ++9w0BAQsFAAOCAgEAjQejd3CXVRh3f2L3nZquYzHO2WT+oyRVhCYkyXHVGyQ2x61j ++wdjlbciDyoa01BmcaTUP72tKeT0TPF94NDaznht2BaB64qJMPTTRFngcTTPEN3Mw ++f/nc6W/dQQ0bGf9VfYm1WXuOdhoDTxjimaw2zEDzPSVl0lLGG+jNHTjoYlnpTOS6 ++BhrJ7lOvs/uC5KUsHJld1bLWPU/ApqyMjJjz+Oc1hLI8JFg8ekZxO+B8h5us7mTs ++VidnlUq2agyrVi2yHVQ892cOBlpzkRSXr+8SNwyezq/8iw/pmu9WT3Ibfqb1SRwY ++iMQV+4RgGzb+c+MAjJQVZAUH50cS1w7KsuQLGthUs2ZUvJJJfYHvPll7F1OWSZO7 ++lFor5EQ9GK1LTUv266OyozwIjXfK4ZzIM+bYURGAejQonSeHdsBJEQMC9yVidSon ++7UeIsznzoXTL0nuFTDD3viL0loE5rq06L7Gn2jhQMp9TeUU/ZWmjBA+fZMQsYXO2 ++P5S0zKOVNFtzJPoPUjsym/qjhRx2tBBVrTt9HilQ3omEC1dgv5IBNs+NDQvTRSqC ++8JZw9nsdL37lvj2k5bMyFlcR76yN9KLROZ7vFZM85vkhuamyve3GnXWcVPCKOHNI ++umvjh5/Zxoz3yy6YnensCbHe88wBQ4jDVN3VMngQ7lw5jJF0aPy40cE1vVU= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/362.pem b/repos/system_upgrade/common/files/prod-certs/10.3/362.pem +new file mode 100644 +index 00000000..fcab2303 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/362.pem +@@ -0,0 +1,36 @@ ++-----BEGIN CERTIFICATE----- ++MIIGNzCCBB+gAwIBAgIJALDxRLt/tVD/MA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzczOVoXDTQ2MDIx ++OTEwMzczOVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFsyZmQwM2Ez ++My0yMmI0LTQyYzktYjFlYS00NWNmOTc1YTNmMzddMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBwDCBvTAJBgNVHRMEAjAAMEgGDCsGAQQBkggJAYJqAQQ4DDZSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIFBvd2VyLCBsaXR0bGUgZW5kaWFuIEJldGEw ++GwYMKwYBBAGSCAkBgmoCBAsMCTEwLjMgQmV0YTAZBgwrBgEEAZIICQGCagMECQwH ++cHBjNjRsZTAuBgwrBgEEAZIICQGCagQEHgwccmhlbC0xMCxyaGVsLTEwLWJldGEt ++cHBjNjRsZTANBgkqhkiG9w0BAQsFAAOCAgEAMDrgDsBEldXi0BAkyWaHShs9UINL ++pkqFi4Xizj3x8TsnAawgRSVnctoOif9xKaSCU1FabDKjJKMsB3/tS/trgRF6YOdT ++UWfnUYkLb0KWlwlRHGEAcymzR+9UqCtnicOW/rLHuOfBBMQPZuT3zIoNn9UUS40/ ++wE5GVnpdZ/xUMSDBbbCusZmkhLXnuzZMRz517O5ST/N8ilQtSaTg1Ea2O2inmEGb ++tc3zZSDhOi/KEVwUSaIa8U5w/L7jNaisCRPXnnNumzc7kLUJmJnmXee++qpjyLiT ++41IP1EDGHYReCsHjCw+0CWkDNvtyc172eTgKUZNPvmTwGoGknX0h6RSvc5pejcI5 ++/aOahHYI11EKt76WNdFCUSD7s2xQOYTu72DJvHXkb/DxcmZmVWjetip9g3Wd29cg ++NwO6l47bsMY6IO76wz3YAh+GE430UHNPyqyog43Yp0TDN404wyJRhg8zHe8cL0UO ++c7jDnsL7eLFQhcF9tKPdBvtlkPt18QcaHVoYYseovUA9ICrgkYQrqAR8cLfD+L01 ++64IU4Ao8MKl8MJbSAcc12m4OnwKLS5ZhybbKa4CAZI3rFLl+XP8ZPCEkF18shKwW ++Y7eezpUuJyRhmG8VlpWECMRuXlQPiJ7AxtBp2/ITwRcS9nRVEat0a6zSaxe3jB/C ++FqTGy2sKtQ5i0bg= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/363.pem b/repos/system_upgrade/common/files/prod-certs/10.3/363.pem +new file mode 100644 +index 00000000..e2d07f1c +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/363.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGKTCCBBGgAwIBAgIJALDxRLt/tVD+MA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzczOFoXDTQ2MDIx ++OTEwMzczOFowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFszNWQ2NmQz ++NS00YjkwLTRjOWMtODBmOC0xNTEwZWI3Yzg5NGFdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBsjCBrzAJBgNVHRMEAjAAMDoGDCsGAQQBkggJAYJrAQQqDChSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIEFSTSA2NCBCZXRhMBsGDCsGAQQBkggJAYJr ++AgQLDAkxMC4zIEJldGEwGQYMKwYBBAGSCAkBgmsDBAkMB2FhcmNoNjQwLgYMKwYB ++BAGSCAkBgmsEBB4MHHJoZWwtMTAscmhlbC0xMC1iZXRhLWFhcmNoNjQwDQYJKoZI ++hvcNAQELBQADggIBAG97elYADAREgylUKzIDOJtbs8G41TQ/7Wr9u7ND2LR97TPD ++g3wECnVP7ZcFnQmdGpPdOhiwsz2QIS5caHFY6geg/8tjSQ5U8Z9PTCXkPFPEd7qz ++oFTgN6bNTPnrSJonEw1Cj3SzD4zKjvWhwlCg1Yz8KBjijblRiSzLZMO73807U1O5 ++IJ5cPsV7xpnsxmzmFD5CZUojIg9yZptGgeeFkTR1wPM6Pu30KAzzDHlXEcnmRAg4 ++yl34VNEFQTNy2Zf/UlrvqORx91ybhZ3iCkipAQy40zhHo+/v37+gPYfM7+QtKZ83 ++0zP5V3JosOQPnHmED22liqb5XGMIyDXqqHL6VTfYd1aebEHmCxVRt8MePeSMO83A ++WjrsIb2PPiql5NJ+fF1utmBHHbzBWpgDAYy2Iws8BUikx8m2vUiGaGytPF4DI0O3 ++jhQeO6OU0uSEy/n66Bq+HbiB0VTCYVWu56s/Xb2P2FyGAh9UL4qiJJXnJnkDVpnC +++DsMEroGaall+pWo/CtNG7zuEAbhpPHtB9MSlujDPViCtBlaBY52j3mtWdQQZvda ++VSOG9R9e9cwvWtHFCtP2gHqZ0ZYL1HJL413OgseGkybfVoNs4nVqpADDX8dKgNNo ++vuXzqBBASr+VuXuBnLS3fu4cmRb3MRc2ByJBNTE+WE7f89Typ7yJ9YCWG8s0 ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/419.pem b/repos/system_upgrade/common/files/prod-certs/10.3/419.pem +new file mode 100644 +index 00000000..06dcf21d +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/419.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGGjCCBAKgAwIBAgIJALDxRLt/tVCkMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjA0N1oXDTQ2MDEx ++OTE4MjA0N1owRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFthMDgwMGY5 ++YS1lMTYyLTRiNGQtYmZkMS04MTIwNWQ0Yzc2ZGFdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBozCBoDAJBgNVHRMEAjAAMDUGDCsGAQQBkggJAYMjAQQlDCNSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIEFSTSA2NDAWBgwrBgEEAZIICQGDIwIEBgwE ++MTAuMzAZBgwrBgEEAZIICQGDIwMECQwHYWFyY2g2NDApBgwrBgEEAZIICQGDIwQE ++GQwXcmhlbC0xMCxyaGVsLTEwLWFhcmNoNjQwDQYJKoZIhvcNAQELBQADggIBAK16 ++YDfEKnzYJy24cIbGgoc1k8/yRHTH6uXcOTcMrey3Jug2bBjIpgVKw7tUJIus5hyQ ++qcIoLIZFmOIR71viSdBYqAl2Q49creclu9JPWEjmTXCmU9Jxa0YPX1nzgPBgE9E8 ++l/GeU4bjWuQHGJx7tlHOJQVK0TU8LpE9XtEdPZQh9XPIIPPdCou7s8slkouLGoMG ++m4Or6ThhLo2KPUjVwkgkLbOP5ThlLckCbXmKOZfP4FhMOAUlk42FY7SWvfLBJzal ++nY2XS4q4yB2EOx/6B5RciALALg/aP4373ui9CUfzQ0o6ABLdu5fhsyViVNNwDbIv ++zGFFimWX9GzGweBn1fg6QFhefYSxa9lcTREih2wB5QN9WsKPh75BlnM5iraSW3Ln ++W5W2nrbXTDlFrEFvS5t7qKSPJQjZXSYIr6zOOyDySuu0GNG12gmHzUzzcgwNO4bC ++obFCHIulnpJn+dNWCV8MqTTR7sSwzp3Lco9egyKT8QPZh/bN6pLYIS3NhLUoAQYz ++xKTTSBZsGfN5WfvKqozHFWmv5i4Xl/QV3UmxB7Jv1MMTjSsuQdBJ50wyX7brkK1G ++ezO9onaS7XcwFZp59NeAqsyoqyJH1uKAxwuernv5uU1G0lLAMlFj/UVyA0BUUtCO ++ViawI/DBLNPXK83W961HMAElx73V5A2E8aYVoWEV ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/433.pem b/repos/system_upgrade/common/files/prod-certs/10.3/433.pem +new file mode 100644 +index 00000000..62c4b25e +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/433.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGLDCCBBSgAwIBAgIJALDxRLt/tVEAMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzczOVoXDTQ2MDIx ++OTEwMzczOVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFsxNzI4NTFi ++YS03YzhlLTQ2YTYtOGVlNi0xZmExY2YwMDRlOTddMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBtTCBsjAJBgNVHRMEAjAAMEEGDCsGAQQBkggJAYMxAQQxDC9SZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIElCTSB6IFN5c3RlbXMgQmV0YTAbBgwrBgEE ++AZIICQGDMQIECwwJMTAuMyBCZXRhMBcGDCsGAQQBkggJAYMxAwQHDAVzMzkweDAs ++BgwrBgEEAZIICQGDMQQEHAwacmhlbC0xMCxyaGVsLTEwLWJldGEtczM5MHgwDQYJ ++KoZIhvcNAQELBQADggIBAE8oESBqJk1DJwYFe6gOSdrWHk1JDkNfqXHqJoyv7BLi ++KpqVIwEKO4b4Yhv4Hk9RmTgGme4nOo3QlyLSuA5aiQj9smF1b32ZgJmvqJQc5HhI ++rUo8OzFpIQntBNgTu4uL7Co38fXYwogMTfFF3pA2Vi5xA7THz22DZ5UlZMDzF2QT +++OrswAPqMwhWzEyR9yVhPSqN/45YL2FxAqvNgVey+bzZymxCLMS2Sl/Bt2p9foq9 ++sXC+v7C7OlVQl/c/8OW6wVp4bZrP1Q93dNptP2UJnwgiP8I1fCknntBRzajsve6I ++bbsfAyhpUrjpOm8bE0BO2EgGw2C9O8gDPQmQbgGF3sHWtMaog/bhe3u14ZMLoR6j ++wGsYSo0cFfEbksHZfm/JSWL0ILvqaBi65snItdhjGlIx3/I/MvpkiYdrzmowFrMs ++SsQVRaDAhC+0rD48Upt9K5yyuf23Yzae5JKgw5BLiNtdoqJjyj0KoyBeKxfX/f4D ++FfBj63Il7EuHLJI3MgLaKejrHY/YBIPtc2fP5fZfcNNHgMpVlBgLK7Huz/Vnp0tk ++TTyVlzyMSFQDedyws90iulm5ZFjpzkVhr1NUZosbFnmURzCD3a09BuKEMInVaGSQ ++F9LVFcoUuot+U0jqueWCw90XCx7/8bVyTx4uPfj8uSCLT5XV9SQ2gE3qGXe6uozK ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/479.pem b/repos/system_upgrade/common/files/prod-certs/10.3/479.pem +new file mode 100644 +index 00000000..a3061d14 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/479.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGGDCCBACgAwIBAgIJALDxRLt/tVCnMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjA0N1oXDTQ2MDEx ++OTE4MjA0N1owRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFswOWVlMmQx ++Ni02MDM0LTQ1NWItYmQzMi1kZDFjNTc3YzY4OWZdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBoTCBnjAJBgNVHRMEAjAAMDUGDCsGAQQBkggJAYNfAQQlDCNSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIHg4Nl82NDAWBgwrBgEEAZIICQGDXwIEBgwE ++MTAuMzAYBgwrBgEEAZIICQGDXwMECAwGeDg2XzY0MCgGDCsGAQQBkggJAYNfBAQY ++DBZyaGVsLTEwLHJoZWwtMTAteDg2XzY0MA0GCSqGSIb3DQEBCwUAA4ICAQBSUGgZ ++gPVDWm2ioWlWvM6cLVx4LeLT+oDiG96VFsB/DNTRERKdT8bxM1Cnk4O42JoZcRMU ++Hn4LxCNQ1jXuQvKMJds5us9XOViPJ9h3JuLcMTnexBcYedRqmXRact2xvNK8NDFQ ++tNGh4sbe2qBRX+wN1wRgEu/FAz/QtzGyL9BTKja2EFbhesfKod69AAkN8nQ7aIrd ++7mLaTKkws8sFuD77Z5eBNj90WxOnC+pa1wVI/XlKDpxtaMJgxVls36i2lefN9JH1 ++mUIopriBDpld489gdo40qO7kJK8rSRxttZqkIfZQRw6jZIV1vcw+JfI0fCm0OLAP ++ynT76/zq6MdMjXUYtMpmniq1hvmnmQduUlytDZ0jRIXfTZebare7AzL/NPgvDGF3 ++OhmpB9JSdaVzjYoNe/621MObespjh5et7sMyQDnDYm4M0aMRK0mIkzGP8ROEcsQF ++buVJLxYPvqs73MNiwp9UJdyeVByQjTC5IwDMpwHWV3z67d82YbMCH5U3rtNLblw0 ++pBAujM8gQYvP7EhvuyRePUA44n1Ub5pewd0oxZKozM+mC/U7zhLQsnX4Y/qJQHOO ++FIgiejsjrqFNSivly9f0StkI3ZC/MYGRuCADfp/l4vW+fhVnMEnIFF1qIX9Yy39F ++Dy8aW/QtjTXMRqFi/hokF6Q/trZiyAsVt98UZg== ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/486.pem b/repos/system_upgrade/common/files/prod-certs/10.3/486.pem +new file mode 100644 +index 00000000..ec1125a1 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/486.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGJzCCBA+gAwIBAgIJALDxRLt/tVEBMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzczOVoXDTQ2MDIx ++OTEwMzczOVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFs3M2M1Yjhi ++My0wYTZkLTRmNmEtOGZkNS04ZTYyYzM3NTUzMjJdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBsDCBrTAJBgNVHRMEAjAAMDoGDCsGAQQBkggJAYNmAQQqDChSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIHg4Nl82NCBCZXRhMBsGDCsGAQQBkggJAYNm ++AgQLDAkxMC4zIEJldGEwGAYMKwYBBAGSCAkBg2YDBAgMBng4Nl82NDAtBgwrBgEE ++AZIICQGDZgQEHQwbcmhlbC0xMCxyaGVsLTEwLWJldGEteDg2XzY0MA0GCSqGSIb3 ++DQEBCwUAA4ICAQBw3b6RD5lMEEugZlTOPPfgSBFU3pj5LmaRKSKPGV3Icq/rF4i1 ++kNyaOReX7M4klZ0cGQJfpy77W9P97T7srcbOXwKXXW8N0PViC49RqlvD+IgOx3ei ++Ga3zq5ynFyqdnEg3UlG7XMpHW5xZa9+8sw/tBgoVnXKCPq6iy4pU9wy95PbTGhBV ++3MfMqvw6MpTyVa3RNcFwqn/MN8ZbdpBwXh3W+7s+7opZmNoewxc3qZe/Yui1fK1s ++ldnJaWLlRPpRYrvuSMflWiD9Ju1cMi2dPAQ0R9cNRuTZ6i8OvrPJKbXnn/5g2GjY ++M5EZ/mjNAHXQTO1H1P1/vTUcHqO9NlDbjNQJ/Otz6TzbBQQ88px8NQvygaq8aoPF ++t/xTXQbVHSC+OmeVUgElYW8o0ITxvxo1/k8gu/np8jPwtXdtLb9Xpna/bd+Vua2Q ++OVO6GHl4YXkOXgnX1KJWgCKR77q07JUW5vpb8pFMHGCMBDYwVlRVWqwQy5qRmFXU ++ILTwr4ue22D5xB01OgapYGw92nmeojGZ6a7bkIhfp8i6NhvwkSXKuyzZmRkdpNm1 ++qydvt0JICGMAJ3LNqHAIjlc8I+eiVa3EbWNbVSBOM/E59PJ4cmmoIkzRbSJrW+8/ ++ys5fj/MB7KL8DcWkvRtRaYZqfrkslnoKa8f9qT13OeLN6j1woOy0pufRNA== ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/10.3/72.pem b/repos/system_upgrade/common/files/prod-certs/10.3/72.pem +new file mode 100644 +index 00000000..af965bd5 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/10.3/72.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGGTCCBAGgAwIBAgIJALDxRLt/tVCmMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjA0N1oXDTQ2MDEx ++OTE4MjA0N1owRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFtkMGNlYzg1 ++MC1iNjk3LTQyMWQtYjhmZi1hNjczM2ZkODJmMDZdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBojCBnzAJBgNVHRMEAjAAMDsGCysGAQQBkggJAUgBBCwMKlJlZCBIYXQg ++RW50ZXJwcmlzZSBMaW51eCBmb3IgSUJNIHogU3lzdGVtczAVBgsrBgEEAZIICQFI ++AgQGDAQxMC4zMBYGCysGAQQBkggJAUgDBAcMBXMzOTB4MCYGCysGAQQBkggJAUgE ++BBcMFXJoZWwtMTAscmhlbC0xMC1zMzkweDANBgkqhkiG9w0BAQsFAAOCAgEAvObN ++JmEuBIppsXYeD6C8Gr2xSyiKy4cfs9AFeCYdVA/ETGWewdKMUXT9e+LyqwSPFPmO ++PD+bIHsr27hlU+Yy1UHgkGubWv5ZbRxRHsEASqCahKNv4+z6CzoIrM4s2X7CK7Mz ++n5APXrpUQG5RtktP3pVkaZo7rGSHv+lHNLe5uFbMi86xBBGPwJQzEmryhmjrcmZA ++um6nCG4j1wxH4pBqgY8t/UZ2maQQUI1XiE+7a4Gk7CmzlFPRUw46gY4+W9DMskC8 ++r2Z4gCKAdq4WSLdJY/Gj+PsU+BUbDNZBGzzybiiWdIQfxvj+zjhKKB0v6n5KGGFW ++We7Virj70o8NZIb6F5sUBY9xSJDZ/aHhZul+Y30mFfqDxNqIBTFiUHuZ0/nPdGEO ++J2CWr3YsdjMWefueVhaNfEOBCnwx1BVO4Wt/r6wHWAz0FnfWveuw//WoUCxi7bD4 ++XC9M6jK2JsnQ8bkJJP4m4NA5LjXGx+TDQsOvntq+UGZ2/BDtt27/c0oRWjjYTHVJ ++GWMqYvLDGuaf8ieYU0wF+k/kF1Ph0F+Wx7XVypLbC04NUftKi5ZoQuBzHhPj+41t ++yFeh/h1oIMR2Un9D20kWcVzgPuisYmUGHzjN3aTVbwLYOdJz0oLKIePRx8/uHDOU ++hfyGGdFJGmv3K0/kmiJBs8HZL8bp2B9Geb09Vt0= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/279.pem b/repos/system_upgrade/common/files/prod-certs/9.9/279.pem +new file mode 100644 +index 00000000..cb6f4fc6 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/279.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGJTCCBA2gAwIBAgIJALDxRLt/tVDNMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjMxMVoXDTQ2MDEx ++OTE4MjMxMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFtiMjk3Y2I1 ++Ni03NTM0LTQxNGUtODE3My04Yzk1MmNhMzZlZWRdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBrjCBqzAJBgNVHRMEAjAAMEMGDCsGAQQBkggJAYIXAQQzDDFSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIFBvd2VyLCBsaXR0bGUgZW5kaWFuMBUGDCsG ++AQQBkggJAYIXAgQFDAM5LjkwGQYMKwYBBAGSCAkBghcDBAkMB3BwYzY0bGUwJwYM ++KwYBBAGSCAkBghcEBBcMFXJoZWwtOSxyaGVsLTktcHBjNjRsZTANBgkqhkiG9w0B ++AQsFAAOCAgEArnuDgKvwfomGhWQiWrpRqwOEuh47QvnTqdmgwiqDKrD9LX5PGKqU ++5mmEUen7pxop465hRny0+FOylsmuKRuZ0R0uUD1VCFXh5sP/TwkPZsgqdCK0hxMT ++si+vp0j6l0z8PwJoskFAl0YUdPnic7QTigRJrS4/HSMiIeABml6AD965+p45vbKI ++4TvB8tA0NkVYjFmyoHZomopyj1GfXavn4yd1iEDjSATO3ElDV56Jr1d6QLNanVPc ++j3+clP5dsq29DsNx6mwK/yJWRAnsgV3pJhhHLag4eN560REJLVDuFhvw+wk+rhGr ++2UGNJAdWgIt0wV3EIsu5eQtWgzKCaLooqxkLdGXWvINkwIXMGfQtO7qyC+GLba9q ++Kwdk9OoIwH+L20vCH5clCveVDA2dtTO/HZjokbivJaOBeCl7y9y38ePr6q90Xccw ++6JQVLqej8hmJdZh9V+p7V1Y6Aa2IxTbQyjITF/zwBJlbe6lGApthUDk44fgo1NIP ++/chrC4bPlzuigS2BPB4lnoeWn0AutWpBrbmMTCeL67rxKZ4rUD0Yb+19yHKbSSy9 ++PJQ6IOM0b+fWXIrvgCx108RET6gD+RDskgmrhOxm5mE1Xbff1CKVFco4+mrWpzLQ ++1VoOL3HLfyA0NFLzpIUY4EEaj4mW+rHekJrmcvCY+Sr7qOmLXPNSV3I= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/362.pem b/repos/system_upgrade/common/files/prod-certs/9.9/362.pem +new file mode 100644 +index 00000000..a3e4fddf +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/362.pem +@@ -0,0 +1,36 @@ ++-----BEGIN CERTIFICATE----- ++MIIGNDCCBBygAwIBAgIJALDxRLt/tVDnMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzYwMVoXDTQ2MDIx ++OTEwMzYwMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFsyMmE5NjIx ++Zi1jZDg3LTQ1M2EtOGVhYS1hZTU3MTI0YzgwMThdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBvTCBujAJBgNVHRMEAjAAMEgGDCsGAQQBkggJAYJqAQQ4DDZSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIFBvd2VyLCBsaXR0bGUgZW5kaWFuIEJldGEw ++GgYMKwYBBAGSCAkBgmoCBAoMCDkuOSBCZXRhMBkGDCsGAQQBkggJAYJqAwQJDAdw ++cGM2NGxlMCwGDCsGAQQBkggJAYJqBAQcDBpyaGVsLTkscmhlbC05LWJldGEtcHBj ++NjRsZTANBgkqhkiG9w0BAQsFAAOCAgEAv76TVAUrltsb5cbSHPKehKND/s5HNF+s ++WxiNebDXNGZvaePl3acr7oZ4BRDyYwxgsxX7sm/zOG/o5vfxTWY8vXNnD+f0UA92 ++28Xdt8o8V8Rl9A+l2r40uwtrILh7++3+NI3BD+mqRh3yWV6dMuB3wjPsaEOBphFf ++LmamvERK9IaqDnxtWhYJkhne+O5ifZ3m3XkBJ3LdZEnz7dQD/AOl48L02PNljCPv ++df+UiKmeQEBUwFCKE4fusw6YKz86V0JvMs3WpkJOL9e/SaseLfyLIU889s3M2E7Q ++aE4hFO5nTNHFuHQKztrENyE+en8N4Q7QGwCTZSL6ZBXV54CUrSdewg9ud5aK2J3g ++scJ0BLVe5o3w0TXjbRWNwRQvODp0Z46C5CTuE2dtCdzFue01zooS853NfH0O6eor ++SQfWlNZe0uE7C1E5RDe12Ts3SALPJgro1WsqUorOaFWRtzfD1Ouj0/ACAUT/zHRz ++pSP78rMyMYoATy1jXrUcaKa4AWDdiaR4j5hEJS5mcftmKawacUALZprfKI25kbSe ++YLwt6sWv9H17+jQIZT5YvJSMmx45SRctLFF3P6d8oBc65se/tq01yBxdJAvjiMQm ++tj3jc0X2hwCTYOZVdvPc4yAked73pZLyfc2+wzUUeiiMKAOSIvgzFJvmplhjjMn+ +++tMhv83qrzw= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/363.pem b/repos/system_upgrade/common/files/prod-certs/9.9/363.pem +new file mode 100644 +index 00000000..92e32c0e +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/363.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGJjCCBA6gAwIBAgIJALDxRLt/tVDmMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzYwMFoXDTQ2MDIx ++OTEwMzYwMFowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFtmNjIxZDhj ++ZC0wNjFhLTQ4ZDEtYjA1NS0xN2RiMjA1NWRiM2VdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBrzCBrDAJBgNVHRMEAjAAMDoGDCsGAQQBkggJAYJrAQQqDChSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIEFSTSA2NCBCZXRhMBoGDCsGAQQBkggJAYJr ++AgQKDAg5LjkgQmV0YTAZBgwrBgEEAZIICQGCawMECQwHYWFyY2g2NDAsBgwrBgEE ++AZIICQGCawQEHAwacmhlbC05LHJoZWwtOS1iZXRhLWFhcmNoNjQwDQYJKoZIhvcN ++AQELBQADggIBAI766OYXjIHfd/zICG8zsEM7PitMyPhoJBr+EQgYCqbTbpc8EmRj ++pxbVtqtusHxFLKctxOepkGXndmWKp3zP+vHhWoMW+o7fN4QRC0LymnGdI04kWjwz ++1uzsiLmz/h2bXUCdiw4kPy77NLWS1rJZgPCuBFsYnoHqHTiw+ETsTv4rgVx+/wBk ++w/gyn63jlUSVOXKr0CA/nlD875B69hlZOWZcqB7kIO8SPsofUI9Gm524jZT0JG8K ++I8QxQ3vgrdP0edEtcNSnNlb59DcVgRX6F08f6YJdmsXAAeeiC0aSsBMiemFZ5G1g ++RRULjXA7C86mTSdSvgoMbAHzl5qL2jfZa1lyOLJhD5eEe+RUxA19YXKn6l+9/Sar ++EjCx4EtmXFEsejnLRdlBwRmkTQZEiEqrIB45lklIvR1AsH5549OlFtwT1F7dnZqb ++llhNdVqIJyfkkZQ5LxIC04PvZRhiO/wF+r0Xm6KEBaReMMolF7puLjU4vvF1qhSd ++hpRsxlmLIT8slgoGMWojDu0ywfqH8e+kDL7xFF7rd4BAYN7yPpi/afdmkxos8gmu ++aJeO6TsqVOzHtdYstQKkjD/wyggd/wyCoisF/lc8Kpa0wKoaC7EATIaCbHM8JgaB ++VZwRdgyiUKAYUIXsJR4o6xw7Vgr+AAcWEQs31lSXz5jNc91l5pEpG8RY ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/419.pem b/repos/system_upgrade/common/files/prod-certs/9.9/419.pem +new file mode 100644 +index 00000000..28cca770 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/419.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGFzCCA/+gAwIBAgIJALDxRLt/tVDMMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjMxMVoXDTQ2MDEx ++OTE4MjMxMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFs2ZTQ5NTEx ++YS03N2U5LTQ2ZGEtYjlmZC00ZjM5MTExNGRkMDZdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBoDCBnTAJBgNVHRMEAjAAMDUGDCsGAQQBkggJAYMjAQQlDCNSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIEFSTSA2NDAVBgwrBgEEAZIICQGDIwIEBQwD ++OS45MBkGDCsGAQQBkggJAYMjAwQJDAdhYXJjaDY0MCcGDCsGAQQBkggJAYMjBAQX ++DBVyaGVsLTkscmhlbC05LWFhcmNoNjQwDQYJKoZIhvcNAQELBQADggIBAI/SbbIL ++2P+C2n7M4MG3Y5wDItsV2fpcJA9tmf8cLujKwWcXtH/B1vG4zcPL8yC27CXLokUP ++CIGTrRvBbpeGFlL09n57zR5n2npAX9ViIAav//NrZW5gD8oS70Ty8CBsDZs2bAkr ++YFK59o2YEG295Ee/CYCE9rYeOBBNwMnw5VOtQ1p88xPD64bSCnBXvCHqOppsSsoT ++wi456fTBAo4diZoVIboliiCAqGex7GWy42KLdfkbqcDMkd7CEcFWLansGuZ4T1KW ++H7YcMg3iGRh6W1lD7bzPwIxr1cN+st4dHcnhIefWM1GhN/9emauzT0DcPb3O8zHb ++90QS0LlFaW9Za59epnqEE7UMb3IKiVCzSpspXeJLl8C2ebqZ4vpXZa1Lvb323g9T ++WXpPdRXHux9QhqbukBTNq6fAJPUrSmyv669uqxKGDaTx80BychQ0gOwNZwyriUWw ++5bT9uYk1fQvMXDDx990+c/er+jiUrgkQ4pM5k2wYJ6ZoRLMs+FfGsgmCr+faAX7b ++oYb6hNrYf71he6PwvZX1OdBR95FMe8Gp5KhncIuaUakecdmnlQrF1ensZMBpXOkU ++49bLOxRW2qMG82PtE0JjX4SH0R2PPiN+3zzzKx54lwi9sb26R6X+vyj8FGVw6G7Y ++Cq4KPL2SFKWZEQd18KCn7e/Gfy5CqeM4CL+9 ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/433.pem b/repos/system_upgrade/common/files/prod-certs/9.9/433.pem +new file mode 100644 +index 00000000..0a452280 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/433.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGKTCCBBGgAwIBAgIJALDxRLt/tVDoMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzYwMVoXDTQ2MDIx ++OTEwMzYwMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFszNjU5Nzli ++Mi0zM2I3LTRkMjUtOWNjZi05NWEyMjEwMThkMWRdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBsjCBrzAJBgNVHRMEAjAAMEEGDCsGAQQBkggJAYMxAQQxDC9SZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIElCTSB6IFN5c3RlbXMgQmV0YTAaBgwrBgEE ++AZIICQGDMQIECgwIOS45IEJldGEwFwYMKwYBBAGSCAkBgzEDBAcMBXMzOTB4MCoG ++DCsGAQQBkggJAYMxBAQaDBhyaGVsLTkscmhlbC05LWJldGEtczM5MHgwDQYJKoZI ++hvcNAQELBQADggIBAG+LbhavNNyjFpe73VgrDyFNpzc97qASwH+8LxFDkeNLOABt ++2HLCffvIPtkSHw09NyphSwmLfA8t2QN7t2R+HD7EP0QiM/sybcY6Kra2XwAPawla ++AZvDhWz/ks46szcYBw2FpIXWeXdkZS0qL89iSgWpzcMqXJrUn5n1W0O8dc6zwSXe ++gFUCu51833edg4TEEB0Iek/Wga3f5BS2vhNYae4vAoGSv0IFx4tx0nPdQ7iuDwLF ++uJcrpVtA/gYzxnaFWceydj1/Qy0S6xwdPUkJ4jNnm9lJpFeHKnJfOT3R7YlRbHL1 ++fZYodsMweDf9FD35lTiBRaMOVytZ3Vff7sDwC9p9OpdikaddzIYE+2IZqxzytBgN ++/kTuLWBWebxMeyYTAUsYFjGn2CGCunjvyPzZH7jSSD75MtbwCOA/I1eIP1p6PLXm ++1innvidGqVd6ma+V8CJprOncMzWuFxLFhE59OlYCkGJVB9h2nj1CbSudBeoLWooU ++/O+XBnoVhTPEI8kuNuj6F1A/K6EYysnGMOccGfh5MuZmkep7pKm61pLyjVW7GVek ++VUQusRh1UChQ0ciOcxT41O0Y1RkhUXphscbnfcvwSekw32QnphRK1kL+91rjuv2H ++uhFhs7PFLHJAF+9xSLqbAcwhx1uCO0g00i4rYtBBfF17LhK4MKOULmG0GwzV ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/479.pem b/repos/system_upgrade/common/files/prod-certs/9.9/479.pem +new file mode 100644 +index 00000000..e2d77de6 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/479.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGFTCCA/2gAwIBAgIJALDxRLt/tVDPMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjMxMVoXDTQ2MDEx ++OTE4MjMxMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFsxYWQyY2Rj ++My1lZjFmLTRmYjgtOWY5Yy1jYTM5YmIxMTY3MmFdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBnjCBmzAJBgNVHRMEAjAAMDUGDCsGAQQBkggJAYNfAQQlDCNSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIHg4Nl82NDAVBgwrBgEEAZIICQGDXwIEBQwD ++OS45MBgGDCsGAQQBkggJAYNfAwQIDAZ4ODZfNjQwJgYMKwYBBAGSCAkBg18EBBYM ++FHJoZWwtOSxyaGVsLTkteDg2XzY0MA0GCSqGSIb3DQEBCwUAA4ICAQCAiyTu7hNM ++WjpoQuttHFFyJKi1doSes65irNUEKjfP+TG3WagiNVAWX6ItUSvpuYJRUP1tPovN ++c8KgLygC5UAKoHik2nWQiELofB4/bqUU0fIbr48OlyrjcM4MDyCLrbUJtGJ/urwn ++XE/X9AzHld/lLOwpP/oLH7ATyH+R0unNrPZmz0Orr4B+B12geL7R1LtCSZwJ2Oc4 ++yWkBQEEsyzogHyD/559SCgqirZAcu3huJhlwEygylX48SGBPhDXQhGyxq0kxAsoS ++swpfjdwzv36AYvWgV2p6/XhIlKC1ffwEoB4mFcPJqV4pS0h3ggFTvT5cakzXxiXN ++tBvokdylBjG5yfyRQxXLIiVkjrm2I1Xk6cm4pQMmG5NJ7iTVmfvHQd0/kRM4Tpk1 ++6LHMlBe0j9ZkWNo1PifmKAeckm+KYsDtkn5jSyHartOlCO+a8BEl5H5RpcI5sbo2 ++2mPqx6+hHBQqe9VBdb/YM7Jd3h+D5uAFB5MkNUEGXf9R5OTkqTLWs6bVaTWD1k9j ++Y76CyBWQLU00jh/SVwGzoaZoa6nx7Q0mFKwgRsahlzV2w3xHtt3bke0IqjxNqcey ++PYs/vGX5fSmNgavw/O+oD8x2jyPYqAJibcfQiVDEJ5liN3UALtfcEcU4cUZWDOkR ++cdcP0vsXkUDltPqfD0WkJUfMuToI+HWPaQ== ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/486.pem b/repos/system_upgrade/common/files/prod-certs/9.9/486.pem +new file mode 100644 +index 00000000..c88a6324 +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/486.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGJDCCBAygAwIBAgIJALDxRLt/tVDpMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDIxOTEwMzYwMVoXDTQ2MDIx ++OTEwMzYwMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFtkY2I3ZGU0 ++NC03NzExLTQ2NWUtYjA1Ny1iMTdlZjlmYjhkYTddMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBrTCBqjAJBgNVHRMEAjAAMDoGDCsGAQQBkggJAYNmAQQqDChSZWQgSGF0 ++IEVudGVycHJpc2UgTGludXggZm9yIHg4Nl82NCBCZXRhMBoGDCsGAQQBkggJAYNm ++AgQKDAg5LjkgQmV0YTAYBgwrBgEEAZIICQGDZgMECAwGeDg2XzY0MCsGDCsGAQQB ++kggJAYNmBAQbDBlyaGVsLTkscmhlbC05LWJldGEteDg2XzY0MA0GCSqGSIb3DQEB ++CwUAA4ICAQB8PbMkfGPmDhdmofA96A1foPosi9TOpcc8r7XMgWVrfeDEkiYSkxTg ++NzECXe06U+aX3ZfkFYLqTcU2KXStb3diW3FqSA0IMLKw9juA714DgKQsDH289qJo ++rPRNWMHWmA17dbx/vmlD/z8E3zUeHzf7m7GcmmJ4VO2mXeNuEZ0Gt/ASlhgNAolw ++6/KNapD3/BoxD16RSVen7eLn3S9hgsNieaTI9n1srBB7U8X9+JEHbOHAqFMwtFzG ++Xf9w3LtpO877Uh7f5UFKQEERP0ImJoLOPZ57R7c8yDjEuuxxtnrCYpXZMNyoBs6o ++x0E4ScP70UI0+XUFtXHlzmvL/DsTI113biAkjDs3kThE9EXV3f/MP8Wyy1BDvEwr ++v9RUsRbdrhTd98gqJ55tmscettCSe/R4reaJ8eDNlG8EEGrKobTeBaut4683JX+J ++0ffjkAAgBou28pGpUYItTCXVtCN+rWoqrDl0kVdh2BuwHg9hxRAtosr94pjfK+UM ++NT6pzLb5dETxH9eiprL3pQC+Gzr2DpqwHlSvFAZUnUMJEnujkVXSEXliGaWNJ1BR ++lDAqEoDCQiiuB50DyPzC8gh9I7+mxW77o9+Qy22crSEAkh0TiMlwKr4DW0NVcj1n ++RrcJQ8TlIZBR8cxd0IrUjVvWjtYQQ7VMHsdaN3I9pvGbOtM2wiLb+w== ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/prod-certs/9.9/72.pem b/repos/system_upgrade/common/files/prod-certs/9.9/72.pem +new file mode 100644 +index 00000000..d192b1bf +--- /dev/null ++++ b/repos/system_upgrade/common/files/prod-certs/9.9/72.pem +@@ -0,0 +1,35 @@ ++-----BEGIN CERTIFICATE----- ++MIIGFjCCA/6gAwIBAgIJALDxRLt/tVDOMA0GCSqGSIb3DQEBCwUAMIGuMQswCQYD ++VQQGEwJVUzEXMBUGA1UECAwOTm9ydGggQ2Fyb2xpbmExFjAUBgNVBAoMDVJlZCBI ++YXQsIEluYy4xGDAWBgNVBAsMD1JlZCBIYXQgTmV0d29yazEuMCwGA1UEAwwlUmVk ++IEhhdCBFbnRpdGxlbWVudCBQcm9kdWN0IEF1dGhvcml0eTEkMCIGCSqGSIb3DQEJ ++ARYVY2Etc3VwcG9ydEByZWRoYXQuY29tMB4XDTI2MDExOTE4MjMxMVoXDTQ2MDEx ++OTE4MjMxMVowRDFCMEAGA1UEAww5UmVkIEhhdCBQcm9kdWN0IElEIFtmOWU0ZTkx ++Mi1mMmFiLTRhMGYtYTM1Mi00M2E1YmY2NTc4YTBdMIICIjANBgkqhkiG9w0BAQEF ++AAOCAg8AMIICCgKCAgEAxj9J04z+Ezdyx1U33kFftLv0ntNS1BSeuhoZLDhs18yk ++sepG7hXXtHh2CMFfLZmTjAyL9i1XsxykQpVQdXTGpUF33C2qBQHB5glYs9+d781x ++8p8m8zFxbPcW82TIJXbgW3ErVh8vk5qCbG1cCAAHb+DWMq0EAyy1bl/JgAghYNGB ++RvKJObTdCrdpYh02KUqBLkSPZHvo6DUJFN37MXDpVeQq9VtqRjpKLLwuEfXb0Y7I ++5xEOrR3kYbOaBAWVt3mYZ1t0L/KfY2jVOdU5WFyyB9PhbMdLi1xE801j+GJrwcLa ++xmqvj4UaICRzcPATP86zVM1BBQa+lilkRQes5HyjZzZDiGYudnXhbqmLo/n0cuXo ++QBVVjhzRTMx71Eiiahmiw+U1vGqkHhQNxb13HtN1lcAhUCDrxxeMvrAjYdWpYlpI ++yW3NssPWt1YUHidMBSAJ4KctIf91dyE93aStlxwC/QnyFsZOmcEsBzVCnz9GmWMl ++1/6XzBS1yDUqByklx0TLH+z/sK9A+O2rZAy1mByCYwVxvbOZhnqGxAuToIS+A81v ++5hCjsCiOScVB+cil30YBu0cH85RZ0ILNkHdKdrLLWW4wjphK2nBn2g2i3+ztf+nQ ++ED2pQqZ/rhuW79jcyCZl9kXqe1wOdF0Cwah4N6/3LzIXEEKyEJxNqQwtNc2IVE8C ++AwEAAaOBnzCBnDAJBgNVHRMEAjAAMDsGCysGAQQBkggJAUgBBCwMKlJlZCBIYXQg ++RW50ZXJwcmlzZSBMaW51eCBmb3IgSUJNIHogU3lzdGVtczAUBgsrBgEEAZIICQFI ++AgQFDAM5LjkwFgYLKwYBBAGSCAkBSAMEBwwFczM5MHgwJAYLKwYBBAGSCAkBSAQE ++FQwTcmhlbC05LHJoZWwtOS1zMzkweDANBgkqhkiG9w0BAQsFAAOCAgEAG3mRXCVq ++a5hdRH/3YW4Gb6WPLq2Y0JjiLJHIc71Z23lvyKa73tr+NdmhIoQpGWL8VRTJ55Zw ++nz4a09omX7FghrlBRQ8mP+LYM5d6XiqCm5j4TwyV6ppsQMG0i4jME7M3NQvCBZbm ++p1dhUYM8kg6jj4UrMG+900eVE3Jl+PutK7gBMHfY3MCVzzvTLdN1TyO/BC6F19zC ++3LsMvexgU1hS+LOCe2KAv45yLgqaIyrkcnWVX7R0TQKEdZSi4IEqHQDHyAHd17j9 ++pHKvb7CAOOF2/GLgBr1qjy7IF2315aHElnVdnF8OOwOx1QHAhE7yAPA40JZHtmOa ++grmPlwmcdtaqru9mlYveTMDTcB5LDpUwbyh9bQOVTS1Opyo8nQWyvvN/ZKZSX2Nd ++yoW52x0oU73qKc0SHye1bF3wq/Wjh+q3k+MRkEmn8wpZJX9rWeda3THPvqlr8WlV ++AzT/UqYu6YyHPHeW5TGsI1Bf45K3dUhW5ZQs54hDDytDyjLpjU6wqOZbHHTMiqtz ++p/uoSBnWYFdcFbZ8hzsfEkxnL+rXhgyUQH4HSZGZjoqJh8SLU4JyFaRq+ERqTTDd ++B47CD7gyW1oKCAQ5kUdrD0oeCJT82z9EI9nAR5nK70yETWOMNBMrKqXlo8dIaw26 ++39nqXtD2tTOl5WcBObeN1I8w6a0zxHdjHJE= ++-----END CERTIFICATE----- +diff --git a/repos/system_upgrade/common/files/upgrade_paths.json b/repos/system_upgrade/common/files/upgrade_paths.json +index ca0fe590..86521672 100644 +--- a/repos/system_upgrade/common/files/upgrade_paths.json ++++ b/repos/system_upgrade/common/files/upgrade_paths.json +@@ -2,11 +2,12 @@ + "rhel": { + "default": { + "7.9": ["8.10"], +- "8.10": ["9.6", "9.8"], ++ "8.10": ["9.6", "9.8", "9.9"], + "9.6": ["10.0"], + "9.8": ["10.2"], ++ "9.9": ["10.3"], + "7": ["8.10"], +- "8": ["9.6", "9.8"], ++ "8": ["9.6", "9.8", "9.9"], + "9": ["10.0"] + }, + "saphana": { +@@ -26,16 +27,16 @@ + }, + "_virtual_versions": { + "8": "8.10", +- "9": "9.8", +- "10": "10.2" ++ "9": "9.9", ++ "10": "10.3" + } + }, + "almalinux": { + "default": { +- "8.10": ["9.0", "9.1", "9.2", "9.3", "9.4", "9.5", "9.6", "9.7", "9.8"], +- "9.7": ["10.0", "10.1"], +- "8": ["9.0", "9.1", "9.2", "9.3", "9.4", "9.5", "9.6", "9.7", "9.8"], +- "9": ["10.0", "10.1"] ++ "8.10": ["9.0", "9.1", "9.2", "9.3", "9.4", "9.5", "9.6", "9.7", "9.8", "9.9"], ++ "9.9": ["10.0", "10.1", "10.2", "10.3"], ++ "8": ["9.0", "9.1", "9.2", "9.3", "9.4", "9.5", "9.6", "9.7", "9.8", "9.9"], ++ "9": ["10.0", "10.1", "10.2", "10.3"] + } + } + } +-- +2.53.0 + diff --git a/0003-Enable-logrotate.timer-during-8to9-IPU.patch b/0003-Enable-logrotate.timer-during-8to9-IPU.patch new file mode 100644 index 0000000..06d205a --- /dev/null +++ b/0003-Enable-logrotate.timer-during-8to9-IPU.patch @@ -0,0 +1,106 @@ +From b96c610bb27ab5f7ef1ad65a1a763ed2d31b6816 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Tue, 17 Feb 2026 10:23:18 +0100 +Subject: [PATCH 03/44] Enable logrotate.timer during 8to9 IPU + +On el8 logrotate uses cron, on el9 a systemd timer is used. This is not +automatically migrated during an IPU, this patch adds a actor that +does so. + +Jira: RHEL-17361 +--- + .../actors/enablelogrotatetimer/actor.py | 22 +++++++++++++ + .../libraries/enablelogrotatetimer.py | 13 ++++++++ + .../tests/test_enablelogrotatetimer.py | 31 +++++++++++++++++++ + 3 files changed, 66 insertions(+) + create mode 100644 repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/actor.py + create mode 100644 repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/libraries/enablelogrotatetimer.py + create mode 100644 repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/tests/test_enablelogrotatetimer.py + +diff --git a/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/actor.py b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/actor.py +new file mode 100644 +index 00000000..bc3c7ec3 +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/actor.py +@@ -0,0 +1,22 @@ ++from leapp.actors import Actor ++from leapp.libraries.actor import enablelogrotatetimer ++from leapp.models import SystemdServicesInfoTarget, SystemdServicesTasks ++from leapp.tags import FinalizationPhaseTag, IPUWorkflowTag ++ ++ ++class EnableLogrotateTimer(Actor): ++ """ ++ Enable logrotate.timer on the target system after upgrade ++ ++ The logrotate.timer systemd timer unit replaces the traditional cron-based ++ logrotate execution used in RHEL 8. This actor ensures the timer is enabled ++ after the in-place upgrade is complete. ++ """ ++ ++ name = 'enable_logrotate_timer' ++ consumes = (SystemdServicesInfoTarget,) ++ produces = (SystemdServicesTasks,) ++ tags = (FinalizationPhaseTag, IPUWorkflowTag) ++ ++ def process(self): ++ enablelogrotatetimer.process() +diff --git a/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/libraries/enablelogrotatetimer.py b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/libraries/enablelogrotatetimer.py +new file mode 100644 +index 00000000..c9783ae9 +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/libraries/enablelogrotatetimer.py +@@ -0,0 +1,13 @@ ++from leapp.libraries.common.systemd import enable_unit ++from leapp.libraries.stdlib import api, CalledProcessError ++ ++LOGROTATE_TIMER = 'logrotate.timer' ++ ++ ++def process(): ++ try: ++ enable_unit(LOGROTATE_TIMER) ++ except CalledProcessError as e: ++ api.current_logger().error( ++ "Failed to enable {}: {}".format(LOGROTATE_TIMER, e) ++ ) +diff --git a/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/tests/test_enablelogrotatetimer.py b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/tests/test_enablelogrotatetimer.py +new file mode 100644 +index 00000000..f366bd6a +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/enablelogrotatetimer/tests/test_enablelogrotatetimer.py +@@ -0,0 +1,31 @@ ++from leapp.libraries.actor import enablelogrotatetimer ++from leapp.libraries.common.testutils import logger_mocked ++from leapp.libraries.stdlib import api, CalledProcessError ++ ++ ++def test_success(monkeypatch): ++ ++ def mock_enable_unit(unit): ++ assert unit == 'logrotate.timer' ++ ++ monkeypatch.setattr(enablelogrotatetimer, "enable_unit", mock_enable_unit) ++ enablelogrotatetimer.process() ++ ++ ++def test_failed_to_enable(monkeypatch): ++ ++ def mock_enable_unit(unit): ++ assert unit == 'logrotate.timer' ++ raise CalledProcessError( ++ "Failed to enable logrotate.titmer", ++ ["systemctl", "enable", "logrotate.timer"], ++ { ++ "exit_code": 1, ++ "stderr": "err", ++ }, ++ ) ++ ++ monkeypatch.setattr(enablelogrotatetimer, "enable_unit", mock_enable_unit) ++ monkeypatch.setattr(api, "current_logger", logger_mocked()) ++ enablelogrotatetimer.process() ++ assert "Failed to enable logrotate.timer" in api.current_logger.errmsg[0] +-- +2.53.0 + diff --git a/0004-feat-net-naming-scheme-enable-by-default-on-CS-9to10.patch b/0004-feat-net-naming-scheme-enable-by-default-on-CS-9to10.patch new file mode 100644 index 0000000..1e71922 --- /dev/null +++ b/0004-feat-net-naming-scheme-enable-by-default-on-CS-9to10.patch @@ -0,0 +1,63 @@ +From 0e0db2860587d57193a52135ae88df8917d70538 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Wed, 11 Feb 2026 16:51:41 +0100 +Subject: [PATCH 04/44] feat(net-naming-scheme): enable by default on CS 9to10 + +This was done for RHEL 9to10 in +91f37a3913c1608b24c9aa583ac3b13a08aace71. + +Jira: RHEL-148291 +--- + .../libraries/emit_net_naming.py | 10 ++++------ + .../tests/test_emit_net_naming_scheme.py | 9 ++------- + 2 files changed, 6 insertions(+), 13 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/emit_net_naming_scheme/libraries/emit_net_naming.py b/repos/system_upgrade/common/actors/emit_net_naming_scheme/libraries/emit_net_naming.py +index 7b112ff0..ef2c0b79 100644 +--- a/repos/system_upgrade/common/actors/emit_net_naming_scheme/libraries/emit_net_naming.py ++++ b/repos/system_upgrade/common/actors/emit_net_naming_scheme/libraries/emit_net_naming.py +@@ -1,5 +1,5 @@ + from leapp.exceptions import StopActorExecutionError +-from leapp.libraries.common.config import get_env, get_target_distro_id, version ++from leapp.libraries.common.config import get_env, version + from leapp.libraries.stdlib import api + from leapp.models import ( + KernelCmdline, +@@ -49,11 +49,9 @@ def is_net_scheme_compatible_with_current_cmdline(): + def emit_msgs_to_use_net_naming_schemes(): + is_feature_enabled = get_env('LEAPP_DISABLE_NET_NAMING_SCHEMES', '0') != '1' + +- is_net_naming_available = version.get_target_major_version() == "9" or ( +- version.matches_target_version(">= 10.2") +- # TODO the net-naming-sysattrs pkg is not yet available on CS10, remove +- # this when it becomes +- and not get_target_distro_id() == "centos" ++ is_net_naming_available = ( ++ version.get_target_major_version() == "9" ++ or version.matches_target_version(">= 10.2") + ) + + if not (is_feature_enabled and is_net_naming_available): +diff --git a/repos/system_upgrade/common/actors/emit_net_naming_scheme/tests/test_emit_net_naming_scheme.py b/repos/system_upgrade/common/actors/emit_net_naming_scheme/tests/test_emit_net_naming_scheme.py +index 9c1f91bb..d8eef404 100644 +--- a/repos/system_upgrade/common/actors/emit_net_naming_scheme/tests/test_emit_net_naming_scheme.py ++++ b/repos/system_upgrade/common/actors/emit_net_naming_scheme/tests/test_emit_net_naming_scheme.py +@@ -95,13 +95,8 @@ def test_emit_msgs_to_use_net_naming_schemes( + pkg_name = emit_net_naming_lib.NET_NAMING_SYSATTRS_RPM_NAME[target_major] + produced_messages = api.produce.model_instances + +- if ( +- is_net_scheme_enabled +- # the package is available since 10.2 +- and target_ver != "10.0" +- # TODO not yet available in CS 10, remove this when it is +- and not (target_distro == "centos" and target_major == "10") +- ): ++ # the package is available since 10.2 ++ if is_net_scheme_enabled and target_ver != "10.0": + userspace_tasks = ensure_one_msg_of_type_produced(produced_messages, TargetUserSpaceUpgradeTasks) + assert userspace_tasks.install_rpms == [pkg_name] + +-- +2.53.0 + diff --git a/0005-Leapp_resume.service-Silence-AVC-SELinux-warnings.patch b/0005-Leapp_resume.service-Silence-AVC-SELinux-warnings.patch new file mode 100644 index 0000000..f84fac7 --- /dev/null +++ b/0005-Leapp_resume.service-Silence-AVC-SELinux-warnings.patch @@ -0,0 +1,46 @@ +From 26e4ca841b23907eda2de78288183285e6b54b1f Mon Sep 17 00:00:00 2001 +From: karolinku +Date: Tue, 3 Mar 2026 13:56:26 +0100 +Subject: [PATCH 05/44] Leapp_resume.service: Silence AVC SELinux warnings + +Wrap the ExecStart command in `/bin/sh -c` to avoid SELinux AVC denials. + +The leapp_resume.service unit is inherently "malformed" from SELinux's +perspective: it directly executes /root/tmp_leapp_py3/leapp3, which is +labeled admin_home_t. When the system boots in Permissive mode (as it +does during the upgrade), SELinux logs AVC denials for this access +rather than blocking it. These AVCs are expected but noisy and +confusing. + +By invoking the command through /bin/sh -c, the execution context is +evaluated against /bin/sh (which carries a proper shell_exec_t label), +avoiding the admin_home_t AVC altogether. + +It is also confirmed with SELinux team that this issue could be +solved with also following solution (in case of any future issues): +``` +ExecStartPre=chcon -t bin_t /root/tmp_leapp_py3/leapp3 +ExecStart=/root/tmp_leapp_py3/leapp3 upgrade --resume +```` + +Jira: RHEL-149141 +--- + .../actors/createresumeservice/files/leapp_resume.service | 2 +- + 1 file changed, 1 insertion(+), 1 deletion(-) + +diff --git a/repos/system_upgrade/common/actors/createresumeservice/files/leapp_resume.service b/repos/system_upgrade/common/actors/createresumeservice/files/leapp_resume.service +index 39ac6112..859237a1 100644 +--- a/repos/system_upgrade/common/actors/createresumeservice/files/leapp_resume.service ++++ b/repos/system_upgrade/common/actors/createresumeservice/files/leapp_resume.service +@@ -9,7 +9,7 @@ Wants=network-online.target + [Service] + Type=oneshot + # FIXME: this is temporary workaround for Python3 +-ExecStart=/root/tmp_leapp_py3/leapp3 upgrade --resume ++ExecStart=/bin/sh -c "/root/tmp_leapp_py3/leapp3 upgrade --resume" + StandardOutput=journal+console + # FIXME: this shouldn't be needed, but Satellite upgrade runs installer, and that's slow + TimeoutStartSec=infinity +-- +2.53.0 + diff --git a/0006-Add-API-to-get-a-distro-report-name.patch b/0006-Add-API-to-get-a-distro-report-name.patch new file mode 100644 index 0000000..df1c049 --- /dev/null +++ b/0006-Add-API-to-get-a-distro-report-name.patch @@ -0,0 +1,138 @@ +From 9827568a1e8caeb3e96c0c40a3d7a741997391c6 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Tue, 17 Feb 2026 16:56:43 +0100 +Subject: [PATCH 06/44] Add API to get a distro "report" name + +Add a global variable DISTRO_REPORT_NAMES which can be directly be used +in format_map() or unpacked into format() calls. +There are also source and target fields which can be used in e.g. +fstrings. + +Jira: RHEL-130948 +--- + .../system_upgrade/common/libraries/distro.py | 72 ++++++++++++++++++- + .../common/libraries/tests/test_distro.py | 19 +++++ + 2 files changed, 90 insertions(+), 1 deletion(-) + +diff --git a/repos/system_upgrade/common/libraries/distro.py b/repos/system_upgrade/common/libraries/distro.py +index 34c48a57..1a5e3923 100644 +--- a/repos/system_upgrade/common/libraries/distro.py ++++ b/repos/system_upgrade/common/libraries/distro.py +@@ -1,9 +1,10 @@ + import json + import os ++from collections.abc import Mapping + + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.common import efi, repofileutils, rhsm +-from leapp.libraries.common.config import get_target_distro_id ++from leapp.libraries.common.config import get_source_distro_id, get_target_distro_id + from leapp.libraries.common.config.architecture import ARCH_ACCEPTED, ARCH_X86_64 + from leapp.libraries.common.config.version import get_target_major_version + from leapp.libraries.stdlib import api +@@ -234,6 +235,75 @@ def distro_id_to_pretty_name(distro_id): + }[distro_id] + + ++def _distro_id_to_report_name(distro_id): ++ """ ++ Get the display name for the given distro id. ++ ++ The display name should be used for user facing text, such as in reports. ++ For a real/full name see the :func:`distro_id_to_pretty_name` function. ++ """ ++ return { ++ "rhel": "RHEL", ++ "centos": "CentOS Stream", ++ "almalinux": "AlmaLinux" ++ }[distro_id] ++ ++ ++class _DistroReportNames(Mapping): ++ """ ++ A mapping of distro names to be used in reports. ++ ++ In addition to the properties :attr:`source` and :attr:`target`, this class ++ can be used in :func:`format_map()` or unpacked to :func:`format` where it ++ exposes them as 'source_distro' and 'target_distro'. ++ """ ++ ++ @property ++ def source(self) -> str: ++ """ ++ The source distro report name. ++ ++ :type: str ++ """ ++ return _distro_id_to_report_name(get_source_distro_id()) ++ ++ @property ++ def target(self) -> str: ++ """ ++ The target distro report name. ++ ++ :type: str ++ """ ++ return _distro_id_to_report_name(get_target_distro_id()) ++ ++ def __getitem__(self, key): ++ if key == 'source_distro': ++ return self.source ++ ++ if key == 'target_distro': ++ return self.target ++ ++ raise KeyError(f"Key '{key}' not found in {self.__class__.__name__}") ++ ++ def __len__(self): ++ return 2 ++ ++ def __iter__(self): ++ yield from ['source_distro', 'target_distro'] ++ ++ ++DISTRO_REPORT_NAMES = _DistroReportNames() ++""" ++A mapping of distro "display" names for use in reports. ++ ++Can be used as argument for format_map() or unpacked in format() calls. ++The format string placeholders 'source_distro' and 'target_distro' are then ++replaced by the respective distro names or abbreviations of them. ++ ++See :class:`_DistroReportNames`. ++""" ++ ++ + def get_distro_efidir_canon_path(distro_id): + """ + Get canonical path to the distro EFI directory in the EFI mountpoint. +diff --git a/repos/system_upgrade/common/libraries/tests/test_distro.py b/repos/system_upgrade/common/libraries/tests/test_distro.py +index ec7d8f77..d266a9c6 100644 +--- a/repos/system_upgrade/common/libraries/tests/test_distro.py ++++ b/repos/system_upgrade/common/libraries/tests/test_distro.py +@@ -235,3 +235,22 @@ def test_get_distro_repoids_invalid_repo(monkeypatch): + ) + def test__get_distro_efidir_canon_path(distro, expect): + assert expect == distrolib.get_distro_efidir_canon_path(distro) ++ ++ ++def test_distro_report_names(monkeypatch): ++ current_actor = CurrentActorMocked(src_distro="centos", dst_distro="rhel") ++ monkeypatch.setattr(api, "current_actor", current_actor) ++ ++ assert distrolib.DISTRO_REPORT_NAMES.source == "CentOS Stream" ++ assert distrolib.DISTRO_REPORT_NAMES.target == "RHEL" ++ ++ expect = "CentOS Stream is upstream for RHEL" ++ template = "{source_distro} is upstream for {target_distro}" ++ assert expect == template.format_map(distrolib.DISTRO_REPORT_NAMES) ++ assert expect == template.format(**distrolib.DISTRO_REPORT_NAMES) ++ ++ template = "{source_distro} is {what} for {target_distro}" ++ assert expect == template.format(what='upstream', **distrolib.DISTRO_REPORT_NAMES) ++ ++ template = "{source_distro} is {what} for RHEL" ++ assert expect == template.format(what='upstream', **distrolib.DISTRO_REPORT_NAMES) +-- +2.53.0 + diff --git a/0007-livemode-copy-upgrade-kernel-s-hmac-into-boot.patch b/0007-livemode-copy-upgrade-kernel-s-hmac-into-boot.patch new file mode 100644 index 0000000..b1f9403 --- /dev/null +++ b/0007-livemode-copy-upgrade-kernel-s-hmac-into-boot.patch @@ -0,0 +1,190 @@ +From d6e4afe5c51ac8809649ca395e2ffafc5ab76922 Mon Sep 17 00:00:00 2001 +From: Michal Hecko +Date: Wed, 4 Mar 2026 22:45:18 +0100 +Subject: [PATCH 07/44] livemode: copy upgrade kernel's hmac into /boot + +Copying kernel's HMAC is necessary in order to boot with FIPS mode +enabled. Standard (old) upgrade process copies the kernel HMAC file +already, livemode did not in order to keep the initial implementation +simple. This change adds copying of kernel HMAC also for livemode. + +Jira-ref: RHEL-129571 +--- + .../libraries/upgradeinitramfsgenerator.py | 50 +++++++---- + .../unit_test_upgradeinitramfsgenerator.py | 84 ++++++++++++++++++- + 2 files changed, 118 insertions(+), 16 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/libraries/upgradeinitramfsgenerator.py b/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/libraries/upgradeinitramfsgenerator.py +index 03447b7c..1a0dccd8 100644 +--- a/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/libraries/upgradeinitramfsgenerator.py ++++ b/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/libraries/upgradeinitramfsgenerator.py +@@ -480,6 +480,16 @@ def prepare_boot_files_for_livemode(context): + + copy_target_kernel_from_userspace_into_boot(context, target_kernel_ver, kernel_artifact_name) + ++ uspace_kernel_hmac_path = context.full_path('/lib/modules/{}/.vmlinuz.hmac'.format(target_kernel_ver)) ++ upgrade_kernel_hmac_dest = '/boot/.{}.hmac'.format(kernel_artifact_name) ++ create_upgrade_hmac_from_target_hmac(uspace_kernel_hmac_path, upgrade_kernel_hmac_dest, kernel_artifact_name) ++ api.current_logger().info( ++ 'Written hmac ({0}) for the upgrade kernel (based on {1})'.format( ++ upgrade_kernel_hmac_dest, ++ uspace_kernel_hmac_path ++ ) ++ ) ++ + USERSPACE_ARTIFACTS_PATH = '/artifacts' + context.makedirs(USERSPACE_ARTIFACTS_PATH, exists_ok=True) + userspace_initramfs_dest = os.path.join(USERSPACE_ARTIFACTS_PATH, initramfs_artifact_name) +@@ -493,25 +503,35 @@ def prepare_boot_files_for_livemode(context): + + return BootContent(kernel_path=host_kernel_dest, + initram_path=host_initramfs_dest, +- kernel_hmac_path='') ++ kernel_hmac_path=upgrade_kernel_hmac_dest) ++ ++ ++def _read_file(path): ++ with open(path) as in_file: ++ return in_file.read() ++ ++ ++def _write_file(path, data): ++ with open(path, 'w') as out_file: ++ out_file.write(data) + + +-def create_upgrade_hmac_from_target_hmac(original_hmac_path, upgrade_hmac_path, upgrade_kernel): ++def create_upgrade_hmac_from_target_hmac(original_hmac_path: str, upgrade_hmac_path: str, upgrade_kernel: str): + # Rename the kernel name stored in the HMAC file as the upgrade kernel is named differently and the HMAC file + # refers to the real target kernel +- with open(original_hmac_path) as original_hmac_file: +- hmac_file_lines = [line for line in original_hmac_file.read().split('\n') if line] +- if len(hmac_file_lines) > 1: +- details = ('Expected the target kernel HMAC file to containing only one HMAC line, ' +- 'found {0}'.format(len(hmac_file_lines))) +- raise StopActorExecutionError('Failed to prepare HMAC file for upgrade kernel.', +- details={'details': details}) +- +- # Keep only non-empty strings after splitting on space +- hmac, dummy_target_kernel_name = [fragment for fragment in hmac_file_lines[0].split(' ') if fragment] +- +- with open(upgrade_hmac_path, 'w') as upgrade_kernel_hmac_file: +- upgrade_kernel_hmac_file.write('{hmac} {kernel}\n'.format(hmac=hmac, kernel=upgrade_kernel)) ++ original_hmac_file_content = _read_file(original_hmac_path) ++ hmac_file_lines = [line for line in original_hmac_file_content.split('\n') if line] ++ if len(hmac_file_lines) > 1: ++ details = ('Expected the target kernel HMAC file to containing only one HMAC line, ' ++ 'found {0}'.format(len(hmac_file_lines))) ++ raise StopActorExecutionError('Failed to prepare HMAC file for upgrade kernel.', ++ details={'details': details}) ++ ++ # Keep only non-empty strings after splitting on space ++ hmac, dummy_target_kernel_name = [fragment for fragment in hmac_file_lines[0].split(' ') if fragment] ++ ++ upgrade_hmac_content = '{hmac} {kernel}\n'.format(hmac=hmac, kernel=upgrade_kernel) ++ _write_file(upgrade_hmac_path, upgrade_hmac_content) + + + def copy_boot_files(context): +diff --git a/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/tests/unit_test_upgradeinitramfsgenerator.py b/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/tests/unit_test_upgradeinitramfsgenerator.py +index b96bf79f..165a4df0 100644 +--- a/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/tests/unit_test_upgradeinitramfsgenerator.py ++++ b/repos/system_upgrade/common/actors/initramfs/upgradeinitramfsgenerator/tests/unit_test_upgradeinitramfsgenerator.py +@@ -116,7 +116,7 @@ class MockedContext: + self.called_copy_to.append((src, dst)) + self.content.add(dst) + +- def makedirs(self, path): ++ def makedirs(self, path, exists_ok=True): + self.called_makedirs.append(path) + + def remove_tree(self, path): +@@ -402,3 +402,85 @@ def test_copy_modules_duplicate_skip(monkeypatch, kind): + assert context.content + assert len(context.called_copy_to) == 1 + assert debugmsg in upgradeinitramfsgenerator.api.current_logger.dbgmsg ++ ++ ++def test_create_upgrade_hmac_from_target_hmac(monkeypatch): ++ upgrade_hmac_written = False ++ ++ def _read_file_mock(path): ++ assert path == '/original-hmac' ++ return ('ff00a9674033eea61bec48d21a1d2c27eaac9bd6ed4997e31dd0d9307c7a4770eb81df7116c' ++ '4ace25d354a06dfdcd75e38f504f2ea7c1c4bdc95ea7083b701c0 vmlinuz-6.12.0-55.9.1.el10_0.x86_64') ++ ++ def _write_file_mock(path, content): ++ assert path == '/boot/.vmlinuz-upgrade.x86_64.hmac' ++ expected_content = ('ff00a9674033eea61bec48d21a1d2c27eaac9bd6ed4997e31dd0d9307c7a4770eb81df7116c' ++ '4ace25d354a06dfdcd75e38f504f2ea7c1c4bdc95ea7083b701c0 ' ++ 'vmlinuz-upgrade.x86_64\n') ++ assert content == expected_content ++ nonlocal upgrade_hmac_written ++ upgrade_hmac_written = True ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, '_read_file', _read_file_mock) ++ monkeypatch.setattr(upgradeinitramfsgenerator, '_write_file', _write_file_mock) ++ upgradeinitramfsgenerator.create_upgrade_hmac_from_target_hmac( ++ '/original-hmac', '/boot/.vmlinuz-upgrade.x86_64.hmac', 'vmlinuz-upgrade.x86_64') ++ ++ assert upgrade_hmac_written ++ ++ ++def test_prepare_boot_files_for_livemode(monkeypatch): ++ context_mock = MockedContext() ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, ++ '_get_target_kernel_version', ++ lambda ctx: '6.18.3-100.fc42.x86_64') ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, ++ 'get_boot_artifact_names', ++ lambda: ('vmlinuz-upgrade.x86_64', 'initramfs-upgrade.x86_64.img')) ++ ++ upgrade_kernel_present = False ++ initramfs_generated = False ++ upgrade_initramfs_present = False ++ upgrade_kernel_hmac_present = False ++ ++ def copy_target_kernel_mock(context, target_kernel_ver, kernel_artifact_name): ++ nonlocal upgrade_kernel_present ++ upgrade_kernel_present = True ++ ++ def _generate_initramfs_mock(context, userspace_initramfs_dest, target_kernel_ver): ++ nonlocal initramfs_generated ++ initramfs_generated = True ++ ++ def create_upgrade_hmac_from_target_hmac_mock(uspace_kernel_hmac_path, ++ upgrade_kernel_hmac_dest, ++ kernel_artifact_name): ++ assert upgrade_kernel_hmac_dest == '/boot/.vmlinuz-upgrade.x86_64.hmac' ++ nonlocal upgrade_kernel_hmac_present ++ upgrade_kernel_hmac_present = True ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, ++ 'copy_target_kernel_from_userspace_into_boot', ++ copy_target_kernel_mock) ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, ++ 'create_upgrade_hmac_from_target_hmac', ++ create_upgrade_hmac_from_target_hmac_mock) ++ ++ monkeypatch.setattr(upgradeinitramfsgenerator, ++ '_generate_livemode_initramfs', ++ _generate_initramfs_mock) ++ ++ boot_content = upgradeinitramfsgenerator.prepare_boot_files_for_livemode(context_mock) ++ ++ upgrade_initramfs_present = context_mock.called_copy_from[0][1] == '/boot/initramfs-upgrade.x86_64.img' ++ ++ assert upgrade_kernel_present ++ assert initramfs_generated ++ assert upgrade_initramfs_present ++ assert upgrade_kernel_hmac_present ++ ++ assert boot_content.kernel_path == '/boot/vmlinuz-upgrade.x86_64' ++ assert boot_content.initram_path == '/boot/initramfs-upgrade.x86_64.img' ++ assert boot_content.kernel_hmac_path == '/boot/.vmlinuz-upgrade.x86_64.hmac' +-- +2.53.0 + diff --git a/0008-fix-livemode-make-live.dir-is-relative-to-device-roo.patch b/0008-fix-livemode-make-live.dir-is-relative-to-device-roo.patch new file mode 100644 index 0000000..3b69428 --- /dev/null +++ b/0008-fix-livemode-make-live.dir-is-relative-to-device-roo.patch @@ -0,0 +1,131 @@ +From 0fc2075683ffe30b77e83c7d793815e9301fa41d Mon Sep 17 00:00:00 2001 +From: Michal Hecko +Date: Fri, 13 Mar 2026 10:03:19 +0100 +Subject: [PATCH 08/44] fix(livemode): make live.dir is relative to device root + +Booting from an squashfs image (from a local block dev) requires to +parameters: +- identifier of the device where the squashfs image resides +- path to the squashfs image on the given device (aka live.dir) +Therefore, live.dir needs to be set up with a path that is relative to +the device where the image resides. This patch fixes the current +behavior where the path is being taken as it is, i.e., relative to the +root of the source system. + +Jira-ref: RHEL-104379 +--- + .../libraries/addupgradebootentry.py | 29 ++++++++++----- + .../tests/unit_test_addupgradebootentry.py | 36 +++++++++++-------- + 2 files changed, 43 insertions(+), 22 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/addupgradebootentry/libraries/addupgradebootentry.py b/repos/system_upgrade/common/actors/addupgradebootentry/libraries/addupgradebootentry.py +index b28ec57c..5b635a83 100644 +--- a/repos/system_upgrade/common/actors/addupgradebootentry/libraries/addupgradebootentry.py ++++ b/repos/system_upgrade/common/actors/addupgradebootentry/libraries/addupgradebootentry.py +@@ -270,14 +270,26 @@ def local_os_stat(path): + return os.stat(path) + + +-def _get_device_uuid(path): ++def _split_path_on_mount_point(path): ++ """ Split a given path into a prefix where a device is mounted and suffix relative to the device root. """ ++ mount_point = path ++ while not os.path.ismount(mount_point): ++ mount_point = os.path.dirname(mount_point) ++ ++ relative_suffix = path[len(mount_point):] ++ if len(relative_suffix) == 0 or relative_suffix[0] != '/': ++ # relative_suffix is '' if the squashfs dir is set to root (/) ++ # relative_suffix does not start with '/' if the dir is located in /, i.e., /mydir ++ relative_suffix = '/{}'.format(relative_suffix) ++ ++ return (mount_point, relative_suffix) ++ ++ ++def _get_device_uuid(mount_point): + """ +- Find the UUID of a device in which the given path is located. ++ Find the UUID of a device mounted at a given mount point. + """ +- while not os.path.ismount(path): +- path = os.path.dirname(path) +- +- needle_dev_id = local_os_stat(path).st_dev ++ needle_dev_id = local_os_stat(mount_point).st_dev + + for uuid in os.listdir('/dev/disk/by-uuid'): + uuid_fullpath = os.path.join('/dev/disk/by-uuid/', uuid) +@@ -333,8 +345,9 @@ def construct_cmdline_args_for_livemode(): + if livemode_config.url_to_load_squashfs_from: + args['root'] = 'live:{}'.format(livemode_config.url_to_load_squashfs_from) + else: +- args['root'] = 'live:UUID={}'.format(_get_device_uuid(dir_path_containing_liveimg)) +- args['rd.live.dir'] = dir_path_containing_liveimg ++ dev_mount_point, dir_location_on_dev = _split_path_on_mount_point(dir_path_containing_liveimg) ++ args['root'] = 'live:UUID={}'.format(_get_device_uuid(dev_mount_point)) ++ args['rd.live.dir'] = dir_location_on_dev + args['rd.live.squashimg'] = liveimg_filename + + if livemode_config.dracut_network: +diff --git a/repos/system_upgrade/common/actors/addupgradebootentry/tests/unit_test_addupgradebootentry.py b/repos/system_upgrade/common/actors/addupgradebootentry/tests/unit_test_addupgradebootentry.py +index 7341602b..79c05a5d 100644 +--- a/repos/system_upgrade/common/actors/addupgradebootentry/tests/unit_test_addupgradebootentry.py ++++ b/repos/system_upgrade/common/actors/addupgradebootentry/tests/unit_test_addupgradebootentry.py +@@ -279,23 +279,31 @@ def test_get_rdlvm_arg_values(monkeypatch): + assert args == ('A', 'B') + + ++@pytest.mark.parametrize( ++ ('path', 'mount_point', 'suffix'), ++ [ ++ ('/', '/', '/'), ++ ('/dir', '/', '/dir'), ++ ('/dir/squashfs', '/', '/dir/squashfs'), ++ ('/dir/squashfs', '/dir', '/squashfs'), ++ ] ++) ++def test_split_path_on_mount_point(monkeypatch, path, mount_point, suffix): ++ def is_mount_mock(_path): ++ return _path == mount_point ++ ++ monkeypatch.setattr(os.path, 'ismount', is_mount_mock) ++ ++ ret_mount_point, ret_suffix = addupgradebootentry._split_path_on_mount_point(path) ++ assert ret_mount_point == mount_point ++ assert ret_suffix == suffix ++ ++ + def test_get_device_uuid(monkeypatch): + """ + The file in question is /var/lib/file + Underlying partition /var is a device /dev/sda1 (dev_id=10) linked to from /dev/disk/by-uuid/MY_UUID1 + """ +- +- execution_stats = { +- 'is_mount_call_count': 0 +- } +- +- def is_mount_mock(path): +- execution_stats['is_mount_call_count'] += 1 +- assert execution_stats['is_mount_call_count'] <= 3 +- return path == '/var' +- +- monkeypatch.setattr(os.path, 'ismount', is_mount_mock) +- + StatResult = namedtuple('StatResult', ('st_dev', 'st_rdev')) + + def stat_mock(path): +@@ -325,8 +333,8 @@ def test_get_device_uuid(monkeypatch): + + monkeypatch.setattr(os, 'readlink', readlink_mock) + +- path = '/var/lib/file' +- uuid = addupgradebootentry._get_device_uuid(path) ++ mount_point = '/var' ++ uuid = addupgradebootentry._get_device_uuid(mount_point) + + assert uuid == 'MY_UUID1' + +-- +2.53.0 + diff --git a/0009-fix-livemode-change-location-of-source-system-tree.patch b/0009-fix-livemode-change-location-of-source-system-tree.patch new file mode 100644 index 0000000..0767c87 --- /dev/null +++ b/0009-fix-livemode-change-location-of-source-system-tree.patch @@ -0,0 +1,61 @@ +From 3a9cb366b7487bb5cc57e7650447af327c343b0d Mon Sep 17 00:00:00 2001 +From: Michal Hecko +Date: Wed, 18 Mar 2026 09:58:13 +0100 +Subject: [PATCH 09/44] fix(livemode): change location of source system tree + +Before this patch, the generated squashfs image mounts the source system +tree at /run/initramfs/live, which is the location used by dmsquash-live +to mount the block device that holds the squashfs image. This device, +however, might be arbitrary, e.g., it could be hosting /var of the +source system. Therefore, the squashfs system would attempt to mount +multiple things at /run/initramfs/live (/ and /var of the source +system), creating problems. This patch changes the location of the +source system tree to '/run/upgrade'. + +Jira-ref: RHEL-104379 +--- + .../files/do-upgrade.sh | 4 ++-- + .../libraries/prepareliveimage.py | 12 ++++++++++-- + 2 files changed, 12 insertions(+), 4 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/files/do-upgrade.sh b/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/files/do-upgrade.sh +index 4b2f9a1f..51ebddb5 100755 +--- a/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/files/do-upgrade.sh ++++ b/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/files/do-upgrade.sh +@@ -28,8 +28,8 @@ export LEAPPHOME=/root/tmp_leapp_py3 + export LEAPP3_BIN=$LEAPPHOME/leapp3 + + # this was initially a dracut script, hence $NEWROOT. +-# the rootfs is mounted on /run/initramfs/live when booted with dmsquash-live +-export NEWROOT=/run/initramfs/live ++# the rootfs is mounted on /run/upgrade when booted with dmsquash-live ++export NEWROOT=/run/upgrade + + NSPAWN_OPTS="--capability=all --bind=/dev --bind=/dev/pts --bind=/proc --bind=/run/udev --bind=/run/lock" + [ -d /dev/mapper ] && NSPAWN_OPTS="$NSPAWN_OPTS --bind=/dev/mapper" +diff --git a/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/libraries/prepareliveimage.py b/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/libraries/prepareliveimage.py +index 2587bf89..96dadadf 100644 +--- a/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/libraries/prepareliveimage.py ++++ b/repos/system_upgrade/common/actors/livemode/modify_userspace_for_livemode/libraries/prepareliveimage.py +@@ -18,8 +18,16 @@ LEAPP_CONSOLE_SERVICE_FILE = 'console.service' + LEAPP_STRACE_SERVICE_FILE = 'upgrade-strace.service' + """ Service that executes the upgrade while strace-ing the corresponding Leapp's process tree. """ + +-SOURCE_ROOT_MOUNT_LOCATION = '/run/initramfs/live' +-""" Controls where the source system's root will be mounted inside the upgrade image. """ ++SOURCE_ROOT_MOUNT_LOCATION = '/run/upgrade' ++""" ++Controls where the source system's root will be mounted inside the upgrade image. ++ ++Note: This cannot be set to /run/initramfs/live as the path is used by ++ dmsquash-live by default to mount the block device that holds the squashfs ++ image. As this device can be arbitrary (e.g., it can be mounted as /var on the ++ source system), using /run/initramfs/live would cause mounting problems - we ++ would attempt to mount / and also (for example) /var on the same location. ++""" + + + def create_fstab_mounting_current_root_elsewhere(context, host_fstab): +-- +2.53.0 + diff --git a/0010-Respect-distro-names-in-reports.patch b/0010-Respect-distro-names-in-reports.patch new file mode 100644 index 0000000..08d5ee2 --- /dev/null +++ b/0010-Respect-distro-names-in-reports.patch @@ -0,0 +1,1678 @@ +From c5863b121a2ff9e653a0a26a2c769fc0239c1c12 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 17:16:31 +0100 +Subject: [PATCH 10/44] Respect distro names in reports + +Previously, all reports had the distro name (RHEL) hardcoded in titles +and summaries. The reports in the following actors now respect the +source distro and target distro names: +- peseventscanner +- checklvm +- checkluks +- xorgcheck +- motifcheck +- mariadbcheck +- check_default_initramfs +- checkkrb5conf +- libdbcheck +- postgresqlcheck +- checkoldxfs +- networkdeprecations +- checkmysql +- inhibitcgroupsv1 +- checkpamuserdb +- opensslenginescheck +- firewalldcheckallowzonedrifting +- mysqlcheck +- firewalldcheckservicetftpclient +- multipathconfcheck +- mariadbcheck +- opensshdropindirectorycheck +- postgresqlcheck +- nischeck +- opensshsubsystemsftp +- checkcustomnetworkscripts +- checkdeprecatedrpmsignature +- kernelcmdlineconfig +- checkopensslconf + +The remaining reports are handled in the following commits. + +Jira: RHEL-130950 + +Co-Authored-By: Peter Mocary +--- + .../actors/checkluks/libraries/checkluks.py | 11 ++-- + .../actors/checkluks/tests/test_checkluks.py | 4 ++ + .../actors/checklvm/libraries/checklvm.py | 7 ++- + .../libraries/kernelcmdlineconfig.py | 18 +++--- + .../libraries/checkopensslconf.py | 33 +++++----- + .../libraries/pes_events_scanner.py | 28 ++++++--- + .../libraries/customnetworkscripts.py | 7 ++- + .../tests/unit_test_customnetworkscripts.py | 2 + + .../libraries/checkdeprecatedrpmsignature.py | 4 +- + .../firewalldcheckallowzonedrifting/actor.py | 13 ++-- + ...nt_test_firewalldcheckallowzonedrifting.py | 5 +- + .../firewalldcheckservicetftpclient/actor.py | 11 +++- + ...nt_test_firewalldcollectusedobjectnames.py | 4 +- + .../mariadbcheck/libraries/mariadbcheck.py | 41 ++++++------- + .../libraries/multipathconfcheck.py | 53 +++++++++------- + .../tests/test_multipath_conf_check_8to9.py | 9 +++ + .../actors/mysqlcheck/libraries/mysqlcheck.py | 13 ++-- + .../actors/nischeck/libraries/nischeck.py | 31 +++++----- + .../opensshdropindirectorycheck/actor.py | 2 +- + .../libraries/opensshsubsystemsftp.py | 6 +- + .../tests/test_opensshsubsystemsftp.py | 5 +- + .../libraries/postgresqlcheck.py | 61 ++++++++++--------- + .../libraries/check_default_initramfs.py | 11 ++-- + .../checkoldxfs/libraries/checkoldxfs.py | 13 ++-- + .../libraries/inhibitcgroupsv1.py | 11 ++-- + .../checkkrb5conf/libraries/checkkrb5conf.py | 7 ++- + .../actors/libdbcheck/libraries/libdbcheck.py | 44 +++++++------ + .../mariadbcheck/libraries/mariadbcheck.py | 43 ++++++------- + .../actors/motifcheck/libraries/motifcheck.py | 38 ++++++------ + .../mysql/checkmysql/libraries/checkmysql.py | 21 ++++--- + .../mysql/checkmysql/tests/test_checkmysql.py | 4 +- + .../actors/networkdeprecations/actor.py | 27 +++++--- + .../unit_test_networkdeprecations_9to10.py | 7 +++ + .../libraries/opensslenginescheck.py | 14 +++-- + .../component_test_opensslenginescheck.py | 5 +- + .../libraries/checkpamuserdb.py | 10 ++- + .../tests/test_checkpamuserdb.py | 3 + + .../libraries/postgresqlcheck.py | 56 ++++++++--------- + .../actors/xorgcheck/libraries/xorgcheck.py | 32 +++++----- + 39 files changed, 409 insertions(+), 305 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkluks/libraries/checkluks.py b/repos/system_upgrade/common/actors/checkluks/libraries/checkluks.py +index 4626cf63..f3e45b47 100644 +--- a/repos/system_upgrade/common/actors/checkluks/libraries/checkluks.py ++++ b/repos/system_upgrade/common/actors/checkluks/libraries/checkluks.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.libraries.common.config.version import get_source_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import ( + CephInfo, +@@ -50,18 +51,18 @@ def report_inhibitor(luks1_partitions, no_tpm2_partitions): + if luks1_partitions: + + summary += ( +- '\n\nSince RHEL 8 the default format for LUKS encryption is LUKS2.' +- ' Despite the old LUKS1 format is still supported on RHEL systems' ++ '\n\nSince {target_distro} 8 the default format for LUKS encryption is LUKS2.' ++ ' Despite the old LUKS1 format is still supported on {target_distro} systems' + ' it has some limitations in comparison to LUKS2.' + ' Only the LUKS2 format is supported for upgrades.' +- ' The following LUKS1 partitions have been discovered on your system:{}' +- .format(''.join(_formatted_list_output(luks1_partitions))) ++ ' The following LUKS1 partitions have been discovered on your system:{partitions}' ++ .format(**DISTRO_REPORT_NAMES, partitions=''.join(_formatted_list_output(luks1_partitions))) + ) + report_hints.append(reporting.Remediation( + hint=( + 'Convert your LUKS1 encrypted devices to LUKS2 and bind it to TPM2 using clevis.' + ' If this is not possible in your case consider clean installation' +- ' of the target RHEL system instead.' ++ ' of the target {target_distro} system instead.'.format_map(DISTRO_REPORT_NAMES) + ) + )) + report_hints.append(reporting.ExternalLink( +diff --git a/repos/system_upgrade/common/actors/checkluks/tests/test_checkluks.py b/repos/system_upgrade/common/actors/checkluks/tests/test_checkluks.py +index 13b8bc55..0147c4f8 100644 +--- a/repos/system_upgrade/common/actors/checkluks/tests/test_checkluks.py ++++ b/repos/system_upgrade/common/actors/checkluks/tests/test_checkluks.py +@@ -1,3 +1,4 @@ ++from leapp.libraries.common import distro + from leapp.libraries.common.config import version + from leapp.models import ( + CephInfo, +@@ -17,6 +18,9 @@ _REPORT_TITLE_UNSUITABLE = 'Detected LUKS devices unsuitable for in-place upgrad + + def test_actor_with_luks1_notpm(monkeypatch, current_actor_context): + monkeypatch.setattr(version, 'get_source_major_version', lambda: '8') ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ + luks_dump = LuksDump( + version=1, + uuid='dd09e6d4-b595-4f1c-80b8-fd47540e6464', +diff --git a/repos/system_upgrade/common/actors/checklvm/libraries/checklvm.py b/repos/system_upgrade/common/actors/checklvm/libraries/checklvm.py +index 073bfbf4..241461dd 100644 +--- a/repos/system_upgrade/common/actors/checklvm/libraries/checklvm.py ++++ b/repos/system_upgrade/common/actors/checklvm/libraries/checklvm.py +@@ -1,6 +1,7 @@ + import os + + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import ( +@@ -19,9 +20,9 @@ LVM_DEVICES_FILE_PATH_PREFIX = '/etc/lvm/devices' + def _report_filter_detection(): + title = 'LVM filter definition detected.' + summary = ( +- 'Beginning with RHEL 9, LVM devices file is used by default to select devices used by ' +- f'LVM. Since leapp detected the use of LVM filter in the {LVM_CONFIG_PATH} configuration ' +- 'file, the configuration won\'t be modified to use devices file during the upgrade and ' ++ f'Beginning with {DISTRO_REPORT_NAMES.target} 9, LVM devices file is used by default to ' ++ f'select devices used by LVM. Since leapp detected the use of LVM filter in the {LVM_CONFIG_PATH} ' ++ 'configuration file, the configuration won\'t be modified to use devices file during the upgrade and ' + 'the LVM filter will remain in use after the upgrade.' + ) + +diff --git a/repos/system_upgrade/common/actors/kernelcmdlineconfig/libraries/kernelcmdlineconfig.py b/repos/system_upgrade/common/actors/kernelcmdlineconfig/libraries/kernelcmdlineconfig.py +index 98b8b95b..137341b4 100644 +--- a/repos/system_upgrade/common/actors/kernelcmdlineconfig/libraries/kernelcmdlineconfig.py ++++ b/repos/system_upgrade/common/actors/kernelcmdlineconfig/libraries/kernelcmdlineconfig.py +@@ -5,6 +5,8 @@ from leapp import reporting + from leapp.exceptions import StopActorExecutionError + from leapp.libraries import stdlib + from leapp.libraries.common.config import architecture, version ++from leapp.libraries.common.config.version import get_target_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import ( + InstalledTargetKernelInfo, +@@ -120,13 +122,13 @@ def _extract_grubby_value(record): + def report_multple_entries_for_default_kernel(): + if use_cmdline_file(): + report_hint = ( +- 'After the system has been rebooted into the new version of RHEL,' ++ 'After the system has been rebooted into the {target_distro} {target_version},' + ' check that configured default kernel cmdline arguments in /etc/kernel/cmdline ' + ' are correct. In case that different arguments are expected, update the file as needed.' +- ) ++ ).format(**DISTRO_REPORT_NAMES, target_version=get_target_major_version()) + else: + report_hint = ( +- 'After the system has been rebooted into the new version of RHEL,' ++ 'After the system has been rebooted into the {target_distro} {target_version},' + ' check that configured default kernel cmdline arguments are set as expected, using' + ' the `grub2-editenv list` command. ' + ' If different default arguments are expected, update them using grub2-editenv.\n' +@@ -138,7 +140,7 @@ def report_multple_entries_for_default_kernel(): + ' then run the following grub2-editenv command:\n\n' + ' # grub2-editenv - set "kernelopts=root=/dev/mapper/rhel_ibm--root' + ' ro console=tty0 console=ttyS0,115200 rd_NO_PLYMOUTH"' +- ) ++ ).format(**DISTRO_REPORT_NAMES, target_version=get_target_major_version()) + + reporting.create_report([ + reporting.Title('Ensure that expected default kernel cmdline arguments are set'), +@@ -243,14 +245,14 @@ def entrypoint(configs=None): + + if use_cmdline_file(): + report_hint = ( +- 'After the system has been rebooted into the new version of RHEL, you' ++ 'After the system has been rebooted into the {target_distro} {target_version}, you' + ' should take the kernel cmdline arguments from /proc/cmdline (Everything' + ' except the BOOT_IMAGE entry and initrd entries) and copy them into' + ' /etc/kernel/cmdline before installing any new kernels.' +- ) ++ ).format(**DISTRO_REPORT_NAMES, target_version=get_target_major_version()) + else: + report_hint = ( +- 'After the system has been rebooted into the new version of RHEL, you' ++ 'After the system has been rebooted into the {target_distro} {target_version}, you' + ' should take the kernel cmdline arguments from /proc/cmdline (Everything' + ' except the BOOT_IMAGE entry and initrd entries) and then use the' + ' grub2-editenv command to make them the default kernel args. For example,' +@@ -261,7 +263,7 @@ def entrypoint(configs=None): + ' then run the following grub2-editenv command:\n\n' + ' # grub2-editenv - set "kernelopts=root=/dev/mapper/rhel_ibm--root' + ' ro console=tty0 console=ttyS0,115200 rd_NO_PLYMOUTH"' +- ) ++ ).format(**DISTRO_REPORT_NAMES, target_version=get_target_major_version()) + + reporting.create_report([ + reporting.Title('Could not set the kernel arguments for future kernels'), +diff --git a/repos/system_upgrade/common/actors/openssl/checkopensslconf/libraries/checkopensslconf.py b/repos/system_upgrade/common/actors/openssl/checkopensslconf/libraries/checkopensslconf.py +index d005e205..6e7267f5 100644 +--- a/repos/system_upgrade/common/actors/openssl/checkopensslconf/libraries/checkopensslconf.py ++++ b/repos/system_upgrade/common/actors/openssl/checkopensslconf/libraries/checkopensslconf.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.libraries.common.config import architecture, version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM, TrackedFilesInfoSource +@@ -8,7 +9,7 @@ DEFAULT_OPENSSL_CONF = '/etc/pki/tls/openssl.cnf' + URL_CRYPTOPOLICIES = { + '8': 'https://red.ht/rhel-8-system-wide-crypto-policies', + '9': 'https://red.ht/rhel-9-system-wide-crypto-policies', +- '10': 'https://red.ht/rhel-10-system-wide-crypto-policies', # TODO actually make the url ++ '10': 'https://red.ht/rhel-10-system-wide-crypto-policies', + } + + +@@ -22,14 +23,14 @@ def check_ibmca(): + # is deprecated, so keep proper teminology to not confuse users. + summary = ( + 'The presence of openssl-ibmca package suggests that the system may be configured' +- ' to use the IBMCA OpenSSL engine.' +- ' Due to major changes in OpenSSL and libica between RHEL {source} and RHEL {target} it is not' +- ' possible to migrate OpenSSL configuration files automatically. Therefore,' +- ' it is necessary to enable IBMCA providers in the OpenSSL config file manually' +- ' after the system upgrade.' +- .format( +- source=version.get_source_major_version(), +- target=version.get_target_major_version(), ++ ' to use the IBMCA OpenSSL engine. Due to major changes in OpenSSL and libica' ++ ' between {source_distro} {source_version} and {target_distro} {target_version}' ++ ' it is not possible to migrate OpenSSL configuration files automatically.' ++ ' Therefore, it is necessary to enable IBMCA providers in the OpenSSL config file' ++ ' manually after the system upgrade.'.format( ++ source_version=version.get_source_major_version(), ++ target_version=version.get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ) + +@@ -79,7 +80,7 @@ def check_default_openssl(): + # current wording could be inaccurate. + summary = ( + 'The OpenSSL configuration file ({fpath}) has been' +- ' modified on the system. RHEL 8 (and newer) systems provide a crypto-policies' ++ ' modified on the system. {target_distro} 8 (and newer) systems provide a crypto-policies' + ' mechanism ensuring usage of system-wide secure cryptography algorithms.' + ' Also the target system uses newer version of OpenSSL that is not fully' + ' compatible with the current one.' +@@ -92,20 +93,22 @@ def check_default_openssl(): + ' the upgrade if it depends on the current OpenSSL configuration.' + ' Such a problem may be caused by using a particular OpenSSL engine, as' + ' OpenSSL engines built for the' +- ' RHEL {source} system are not compatible with RHEL {target}.' ++ ' {source_distro} {source_version} system are not compatible with' ++ ' {target_distro} {target_version}.' + .format( + fpath=DEFAULT_OPENSSL_CONF, +- source=version.get_source_major_version(), +- target=version.get_target_major_version() ++ source_version=version.get_source_major_version(), ++ target_version=version.get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ) + if version.get_target_major_version() == '9': + # NOTE(pstodulk): that a try to make things with engine/providers a + # little bit better (see my TODO note above) + summary += ( +- '\n\nNote the legacy ENGINE API is deprecated since RHEL 8 and' ++ '\n\nNote the legacy ENGINE API is deprecated since {target_distro} 8 and' + ' it is required to use the new OpenSSL providers API instead on' +- ' RHEL 9 systems.' ++ ' {target_distro} 9 systems.'.format_map(DISTRO_REPORT_NAMES) + ) + hint = ( + 'Check that your ability to login to the system does not depend on' +diff --git a/repos/system_upgrade/common/actors/peseventsscanner/libraries/pes_events_scanner.py b/repos/system_upgrade/common/actors/peseventsscanner/libraries/pes_events_scanner.py +index 7c11fd21..6ba16ced 100644 +--- a/repos/system_upgrade/common/actors/peseventsscanner/libraries/pes_events_scanner.py ++++ b/repos/system_upgrade/common/actors/peseventsscanner/libraries/pes_events_scanner.py +@@ -7,6 +7,7 @@ from leapp.libraries.actor import peseventsscanner_repomap + from leapp.libraries.actor.pes_event_parsing import Action, get_pes_events, Package + from leapp.libraries.common import rpms + from leapp.libraries.common.config import get_target_distro_id, version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.libraries.stdlib.config import is_verbose + from leapp.models import ( +@@ -457,30 +458,37 @@ def replace_pesids_with_repoids_in_packages(packages, source_pkgs_repoids): + + required_target_pesids = {pkg.repository for pkg in packages_with_pesid} + +- pesid_to_repoid_map = get_pesid_to_repoid_map(required_target_pesids) ++ pesid_to_target_repoid_map = get_pesid_to_repoid_map(required_target_pesids) + +- packages_without_known_repoid = {pkg for pkg in packages_with_pesid if pkg.repository not in pesid_to_repoid_map} ++ packages_with_unknown_target_repoid = { ++ pkg ++ for pkg in packages_with_pesid ++ if pkg.repository not in pesid_to_target_repoid_map ++ } + +- if packages_without_known_repoid: ++ if packages_with_unknown_target_repoid: + report_skipped_packages( + title='Packages from unknown repositories may not be installed', + message='packages may not be installed or upgraded due to repositories unknown to leapp:', +- skipped_pkgs=packages_without_known_repoid, ++ skipped_pkgs=packages_with_unknown_target_repoid, + remediation=( +- 'In case the listed repositories are mirrors of official repositories for RHEL' +- ' (provided by Red Hat on CDN)' +- ' and their repositories IDs has been customized, you can change' ++ 'In case the listed repositories are mirrors of official repositories for {}' ++ ' and their repositories IDs have been customized, you can change' + ' the configuration to use the official IDs instead of fixing the problem.' + ' You can also review the projected DNF upgrade transaction result' + ' in the logs to see what is going to happen, as this does not necessarily mean' + ' that the listed packages will not be upgraded. You can also' +- ' install any missing packages after the in-place upgrade manually.' ++ ' install any missing packages after the in-place upgrade manually.'.format( ++ 'RHEL (provided by Red Hat on CDN)' ++ if get_target_distro_id() == 'rhel' ++ else DISTRO_REPORT_NAMES.target ++ ) + ), + ) + +- packages_with_known_repoid = packages_with_pesid.difference(packages_without_known_repoid) ++ packages_with_known_repoid = packages_with_pesid.difference(packages_with_unknown_target_repoid) + packages_with_repoid = { +- Package(p.name, pesid_to_repoid_map[p.repository], p.modulestream) for p in packages_with_known_repoid ++ Package(p.name, pesid_to_target_repoid_map[p.repository], p.modulestream) for p in packages_with_known_repoid + } + # Packages without pesid are those for which we do not have an event, keep them in target packages + return packages_with_repoid.union(packages_without_pesid) +diff --git a/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/libraries/customnetworkscripts.py b/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/libraries/customnetworkscripts.py +index 2947aa27..a4c67efc 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/libraries/customnetworkscripts.py ++++ b/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/libraries/customnetworkscripts.py +@@ -1,6 +1,7 @@ + import os + + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + + CUSTOM_NETWORK_SCRIPTS = [ + "/sbin/ifup-local", +@@ -17,9 +18,9 @@ def generate_report(existing_custom_network_scripts): + # Show documentation url if custom network-scripts detected + title = "custom network-scripts detected" + summary = ( +- "RHEL 9 does not support the legacy network-scripts package that was" +- " deprecated in RHEL 8. Custom network-scripts have been detected." +- ) ++ "{target_distro} 9 does not support the legacy network-scripts package that was" ++ " deprecated in {source_distro} 8. Custom network-scripts have been detected." ++ ).format_map(DISTRO_REPORT_NAMES) + + reporting.create_report( + [ +diff --git a/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/tests/unit_test_customnetworkscripts.py b/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/tests/unit_test_customnetworkscripts.py +index 5f57f5ba..2f3f0469 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/tests/unit_test_customnetworkscripts.py ++++ b/repos/system_upgrade/el8toel9/actors/checkcustomnetworkscripts/tests/unit_test_customnetworkscripts.py +@@ -3,11 +3,13 @@ import os + from leapp import reporting + from leapp.libraries.actor import customnetworkscripts + from leapp.libraries.common import testutils ++from leapp.libraries.stdlib import api + + + def test_customnetworkscripts_exists(monkeypatch): + monkeypatch.setattr(os.path, "isfile", lambda dummy: True) + monkeypatch.setattr(reporting, "create_report", testutils.create_report_mocked()) ++ monkeypatch.setattr(api, "current_actor", testutils.CurrentActorMocked()) + customnetworkscripts.process() + assert reporting.create_report.called + +diff --git a/repos/system_upgrade/el8toel9/actors/checkdeprecatedrpmsignature/libraries/checkdeprecatedrpmsignature.py b/repos/system_upgrade/el8toel9/actors/checkdeprecatedrpmsignature/libraries/checkdeprecatedrpmsignature.py +index 0ab59495..3e8bdbe7 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkdeprecatedrpmsignature/libraries/checkdeprecatedrpmsignature.py ++++ b/repos/system_upgrade/el8toel9/actors/checkdeprecatedrpmsignature/libraries/checkdeprecatedrpmsignature.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import CryptoPolicyInfo, InstalledRPM + +@@ -11,7 +12,7 @@ FMT_LIST_SEPARATOR = '\n - ' + # framework prints external links in the file as well. + SUMMARY_FMT = ( + 'Digital signatures using SHA-1 hash algorithm are no longer considered' +- ' secure and are not allowed to be used on RHEL 9 systems by default.' ++ ' secure and are not allowed to be used on {target_distro} 9 systems by default.' + ' This causes issues when using DNF/RPM to handle packages with RSA/SHA1' + ' signatures as the signature cannot be checked with the default' + ' cryptographic policy. Any such packages cannot be installed, removed,' +@@ -68,6 +69,7 @@ def process(): + report = [ + reporting.Title('Detected RPMs with RSA/SHA1 signature'), + reporting.Summary(SUMMARY_FMT.format( ++ target_distro=DISTRO_REPORT_NAMES.target, + major_changes_url=MAJOR_CHANGE_URL, + crypto_policies_url=CRYPTO_POLICIES_URL, + bad_pkgs=bad_rpms_str +diff --git a/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/actor.py b/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/actor.py +index 6f1c8f43..3b5f87a5 100644 +--- a/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/actor.py ++++ b/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/actor.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.actors import Actor ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.models import FirewalldGlobalConfig, FirewallsFacts + from leapp.reporting import create_report, Report + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag +@@ -34,10 +35,14 @@ class FirewalldCheckAllowZoneDrifting(Actor): + + create_report([ + reporting.Title('Firewalld Configuration AllowZoneDrifting Is Unsupported'), +- reporting.Summary('Firewalld has enabled configuration option ' +- '"{conf_key}" which has been removed in RHEL-9. ' +- 'New behavior is as if "{conf_key}" was set to "no".'.format( +- conf_key='AllowZoneDrifting')), ++ reporting.Summary( ++ 'Firewalld has enabled configuration option "{conf_key}" which' ++ ' has been removed in {target_distro} 9. New behavior is as if ' ++ '"{conf_key}" was set to "no".'.format( ++ target_distro=DISTRO_REPORT_NAMES.target, ++ conf_key='AllowZoneDrifting', ++ ) ++ ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SANITY, reporting.Groups.FIREWALL]), + reporting.Groups([reporting.Groups.INHIBITOR]), +diff --git a/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/tests/component_test_firewalldcheckallowzonedrifting.py b/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/tests/component_test_firewalldcheckallowzonedrifting.py +index 9908fa29..eaeed253 100644 +--- a/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/tests/component_test_firewalldcheckallowzonedrifting.py ++++ b/repos/system_upgrade/el8toel9/actors/firewalldcheckallowzonedrifting/tests/component_test_firewalldcheckallowzonedrifting.py +@@ -1,8 +1,11 @@ ++from leapp.libraries.common import distro + from leapp.models import FirewalldGlobalConfig, FirewallsFacts, FirewallStatus + from leapp.reporting import Report + + +-def test_actor_firewalldcheckallowzonedrifting(current_actor_context): ++def test_actor_firewalldcheckallowzonedrifting(current_actor_context, monkeypatch): ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ + status = FirewallStatus(enabled=True, active=True) + current_actor_context.feed(FirewallsFacts(firewalld=status, + iptables=status, +diff --git a/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/actor.py b/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/actor.py +index f6aa7393..0719ee1e 100644 +--- a/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/actor.py ++++ b/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/actor.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.actors import Actor ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.models import FirewalldUsedObjectNames + from leapp.reporting import create_report, Report + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag +@@ -27,9 +28,13 @@ class FirewalldCheckServiceTftpClient(Actor): + if send_report: + create_report([ + reporting.Title('Firewalld Service tftp-client Is Unsupported'), +- reporting.Summary('Firewalld has service "{service}" enabled. ' +- 'Service "{service}" has been removed in RHEL-9.'.format( +- service=tftp_client_service)), ++ reporting.Summary( ++ 'Firewalld has service "{service}" enabled. ' ++ 'Service "{service}" has been removed in {target_distro} 9.'.format( ++ service=tftp_client_service, ++ target_distro=DISTRO_REPORT_NAMES.target, ++ ) ++ ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SANITY, reporting.Groups.FIREWALL]), + reporting.Groups([reporting.Groups.INHIBITOR]), +diff --git a/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/tests/component_test_firewalldcollectusedobjectnames.py b/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/tests/component_test_firewalldcollectusedobjectnames.py +index ce964301..1ed33fb0 100644 +--- a/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/tests/component_test_firewalldcollectusedobjectnames.py ++++ b/repos/system_upgrade/el8toel9/actors/firewalldcheckservicetftpclient/tests/component_test_firewalldcollectusedobjectnames.py +@@ -1,11 +1,13 @@ ++from leapp.libraries.common import distro + from leapp.models import FirewalldUsedObjectNames + from leapp.reporting import Report + + +-def test_actor_firewalldcheckservicetftpclient(current_actor_context): ++def test_actor_firewalldcheckservicetftpclient(current_actor_context, monkeypatch): + services = ['cockpit', 'tftp-client', 'ssh', 'https'] + policies = [] + zones = [] ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') + + current_actor_context.feed(FirewalldUsedObjectNames(services=services, + policies=policies, +diff --git a/repos/system_upgrade/el8toel9/actors/mariadbcheck/libraries/mariadbcheck.py b/repos/system_upgrade/el8toel9/actors/mariadbcheck/libraries/mariadbcheck.py +index c56c6422..6fe7d669 100644 +--- a/repos/system_upgrade/el8toel9/actors/mariadbcheck/libraries/mariadbcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/mariadbcheck/libraries/mariadbcheck.py +@@ -1,25 +1,9 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM + +-# Summary for mariadb-server report +-report_server_inst_summary = ( +- 'MariaDB server component will be upgraded. Since RHEL-9 includes' +- ' MariaDB server 10.5 by default, which is incompatible with 10.3' +- ' included in RHEL-8, it is necessary to proceed with additional steps' +- ' for the complete upgrade of the MariaDB data.' +-) +- +-report_server_inst_hint = ( +- 'Back up your data before proceeding with the upgrade' +- ' and follow steps in the documentation section "Migrating to a RHEL 9 version of MariaDB"' +- ' after the upgrade.' +-) +- +-# Link URL for mariadb-server report +-report_server_inst_link_url = 'https://access.redhat.com/articles/6743671' +- + + def _report_server_installed(): + """ +@@ -29,15 +13,30 @@ def _report_server_installed(): + installation, warn them about necessary additional steps, and + redirect them to online documentation for the upgrade process. + """ ++ summary = ( ++ 'MariaDB server component will be upgraded. Since {target_distro} 9' ++ ' includes MariaDB server 10.5 by default, which is incompatible with' ++ ' 10.3 included in {source_distro} 8, it is necessary to proceed with' ++ ' additional steps for the complete upgrade of the MariaDB data.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ++ hint = ( ++ 'Back up your data before proceeding with the upgrade and follow steps' ++ ' in the documentation section "Migrating to a RHEL 9 version of MariaDB"' ++ ' after the upgrade.' ++ ) ++ + reporting.create_report([ + reporting.Title('MariaDB (mariadb-server) has been detected on your system'), +- reporting.Summary(report_server_inst_summary), ++ reporting.Summary(summary), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), +- reporting.ExternalLink(title='Migrating to a RHEL 9 version of MariaDB', +- url=report_server_inst_link_url), ++ reporting.ExternalLink( ++ title='Migrating to a RHEL 9 version of MariaDB', ++ url='https://access.redhat.com/articles/6743671' ++ ), + reporting.RelatedResource('package', 'mariadb-server'), +- reporting.Remediation(hint=report_server_inst_hint), ++ reporting.Remediation(hint=hint), + ]) + + +diff --git a/repos/system_upgrade/el8toel9/actors/multipathconfcheck/libraries/multipathconfcheck.py b/repos/system_upgrade/el8toel9/actors/multipathconfcheck/libraries/multipathconfcheck.py +index 31b8bc40..083d3342 100644 +--- a/repos/system_upgrade/el8toel9/actors/multipathconfcheck/libraries/multipathconfcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/multipathconfcheck/libraries/multipathconfcheck.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.reporting import create_report + + +@@ -8,15 +9,18 @@ def _report_foreign(): + 'device-mapper-multipath now defaults to ignoring foreign devices' + ), + reporting.Summary( +- 'In RHEL-9, the default value for the "enable_foreign" option has ' +- 'changed to "NONE". This means that multipath will no longer list ' +- 'devices that are not managed by device-mapper. In order to retain ' +- 'the default RHEL-8 behavior of listing foreign multipath devices, ' +- '\'enable_foreign ""\' will be added to the defaults section of ' +- '"/etc/multipath.conf". If you wish to change to the default ' +- 'RHEL-9 behavior, please remove this line. This option only ' +- 'effects the devices that multipath lists. It has no impact on ' +- 'what devices are managed.'), ++ 'In {target_distro} 9, the default value for the "enable_foreign" ' ++ 'option has changed to "NONE". This means that multipath will no ' ++ 'longer list devices that are not managed by device-mapper. In ' ++ 'order to retain the default {source_distro} 8 behavior of listing ' ++ 'foreign multipath devices, \'enable_foreign ""\' will be added to ' ++ 'the defaults section of "/etc/multipath.conf". If you wish to ' ++ 'change to the default {target_distro} 9 behavior, please remove ' ++ 'this line. This option only affects the devices that multipath ' ++ 'lists. It has no impact on what devices are managed.'.format_map( ++ DISTRO_REPORT_NAMES ++ ) ++ ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.RelatedResource('package', 'device-mapper-multipath') +@@ -29,13 +33,15 @@ def _report_allow_usb(): + 'device-mapper-multipath now defaults to ignoring USB devices' + ), + reporting.Summary( +- 'In RHEL-9, the default multipath configuration has changed to ' +- 'ignore USB devices. A new config option, "allow_usb_devices" has ' +- 'been added to control this. In order to retain the RHEL-8 ' +- 'behavior of treating USB devices like other block devices. ' +- '"allow_usb_devices yes" will be added to the defaults section ' +- 'of "/etc/multipath.conf". If you wish to change to the default ' +- 'RHEL-9 behavior, please remove this line.'), ++ 'In {target_distro} 9, the default multipath configuration has ' ++ 'changed to ignore USB devices. A new config option, ' ++ '"allow_usb_devices" has been added to control this. In order to ' ++ 'retain the {source_distro} 8 behavior of treating USB devices ' ++ 'like other block devices. "allow_usb_devices yes" will be added ' ++ 'to the defaults section of "/etc/multipath.conf". If you wish to ' ++ 'change to the default {target_distro} 9 behavior, please remove ' ++ 'this line.'.format_map(DISTRO_REPORT_NAMES) ++ ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.RelatedResource('package', 'device-mapper-multipath') +@@ -56,11 +62,16 @@ def _report_invalid_regexes(paths): + ), + reporting.Summary( + 'Some options in device-mapper-multipath configuration files ' +- 'have values that are regular expressions. In RHEL-8, if such an ' +- 'option had a value of "*", multipath would internally convert it ' +- 'to ".*". In RHEL-9, values of "*" are no longer accepted. ' +- 'These regular expression values have been found in {}. They ' +- 'will be converted to ".*"'.format(paths_str)), ++ ' have values that are regular expressions. In {source_distro} 8,' ++ ' if such an option had a value of "*", multipath would internally' ++ 'convert it to ".*". In {target_distro} 9, values of "*" are no ' ++ 'longer accepted. ' ++ 'These regular expression values have been found in {paths}. They ' ++ 'will be converted to ".*"'.format( ++ paths=paths_str, ++ **DISTRO_REPORT_NAMES ++ ) ++ ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.RelatedResource('package', 'device-mapper-multipath') +diff --git a/repos/system_upgrade/el8toel9/actors/multipathconfcheck/tests/test_multipath_conf_check_8to9.py b/repos/system_upgrade/el8toel9/actors/multipathconfcheck/tests/test_multipath_conf_check_8to9.py +index b91d414c..981b9455 100644 +--- a/repos/system_upgrade/el8toel9/actors/multipathconfcheck/tests/test_multipath_conf_check_8to9.py ++++ b/repos/system_upgrade/el8toel9/actors/multipathconfcheck/tests/test_multipath_conf_check_8to9.py +@@ -1,3 +1,6 @@ ++import pytest ++ ++from leapp.libraries.common import distro + from leapp.models import MultipathConfFacts8to9, MultipathConfig8to9 + from leapp.reporting import Report + +@@ -35,6 +38,12 @@ def _build_facts(confs): + return MultipathConfFacts8to9(configs=confs) + + ++@pytest.fixture(autouse=True) ++def mock_distro_names(monkeypatch): ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ ++ + def test_need_everything(current_actor_context): + config = _build_config('need_everything.conf', None, False, True, False) + facts = _build_facts([config]) +diff --git a/repos/system_upgrade/el8toel9/actors/mysqlcheck/libraries/mysqlcheck.py b/repos/system_upgrade/el8toel9/actors/mysqlcheck/libraries/mysqlcheck.py +index b446d9c4..c0865812 100644 +--- a/repos/system_upgrade/el8toel9/actors/mysqlcheck/libraries/mysqlcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/mysqlcheck/libraries/mysqlcheck.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.models import DistributionSignedRPM + +@@ -14,16 +15,18 @@ def _report_server_installed(): + reporting.create_report([ + reporting.Title('Further action to upgrade MySQL might be needed'), + reporting.Summary( +- 'The MySQL server component will be reinstalled during the upgrade with a RHEL 9' +- ' version. Since RHEL 9 includes the same MySQL version 8.0 by default, no action' ++ 'The MySQL server component will be reinstalled during the upgrade with a {target_distro} 9' ++ ' version. Since {target_distro} 9 includes the same MySQL version 8.0 by default, no action' + ' should be required and there should not be any compatibility issues. However,' + ' it is still advisable to follow the documentation on this topic for up to date' + ' recommendations.' +- ' Keep in mind that MySQL 8.0, which is the default in RHEL 9, will reach the end' ++ ' Keep in mind that MySQL 8.0, which is the default in {target_distro} 9, will reach the end' + ' of \'Extended Support\' in April 2026. As such it is advisable to upgrade to' + ' MySQL version 8.4, which is provided via a module. MySQL 8.4 is also the' +- ' default version for RHEL 10, therefore having MySQL 8.4 on the RHEL 9 system' +- ' will make a future upgrade process to RHEL 10 smoother.' ++ ' default version for {target_distro} 10, therefore having MySQL 8.4 on the {target_distro} 9 system' ++ ' will make a future upgrade process to {target_distro} 10 smoother.'.format_map( ++ DISTRO_REPORT_NAMES ++ ) + ), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), +diff --git a/repos/system_upgrade/el8toel9/actors/nischeck/libraries/nischeck.py b/repos/system_upgrade/el8toel9/actors/nischeck/libraries/nischeck.py +index c5d85977..9ddd9ca7 100644 +--- a/repos/system_upgrade/el8toel9/actors/nischeck/libraries/nischeck.py ++++ b/repos/system_upgrade/el8toel9/actors/nischeck/libraries/nischeck.py +@@ -1,22 +1,10 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM, NISConfig + +-report_summary = ( +- 'The NIS components (ypserv, ypbind, and yp-tools) are no longer available in RHEL-9.' +- ' The technology behind those packages is based an outdated design patterns, which are' +- ' no longer considered as secure. There is no direct alternative with fully compatible' +- ' features.' +-) +- +-report_hint = ( +- 'The alternatives are LDAP and for some use cases Kerberos or migrating to IPA.' +-) +- +-report_link_url = 'https://access.redhat.com/solutions/5991271' +- + + def report_nis(): + """ +@@ -55,15 +43,26 @@ def report_nis(): + if not rpms_configured_installed: + return + ++ report_summary = ( ++ 'The NIS components (ypserv, ypbind, and yp-tools) are no longer available' ++ ' in {target_distro} 9. The technology behind those packages is based an ' ++ ' outdated design patterns, which are no longer considered as secure. There' ++ ' is no direct alternative with fully compatible features.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ + # Create report + report_content = [ + reporting.Title('NIS component has been detected on your system'), + reporting.Summary(report_summary), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), +- reporting.ExternalLink(title='RHEL 9 (NIS) discontinuation', +- url=report_link_url), +- reporting.Remediation(hint=report_hint), ++ reporting.ExternalLink( ++ title='RHEL 9 (NIS) discontinuation', ++ url='https://access.redhat.com/solutions/5991271', ++ ), ++ reporting.Remediation( ++ hint='The alternatives are LDAP and for some use cases Kerberos or migrating to IPA.' ++ ), + ] + + related_resources = [reporting.RelatedResource('package', pkg) for pkg in rpms_configured_installed] +diff --git a/repos/system_upgrade/el8toel9/actors/opensshdropindirectorycheck/actor.py b/repos/system_upgrade/el8toel9/actors/opensshdropindirectorycheck/actor.py +index 5d52e3ca..4ec85fb0 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensshdropindirectorycheck/actor.py ++++ b/repos/system_upgrade/el8toel9/actors/opensshdropindirectorycheck/actor.py +@@ -50,7 +50,7 @@ class OpenSshDropInDirectoryCheck(Actor): + reporting.Title('The upgrade will prepend the Include directive to OpenSSH sshd_config'), + reporting.Summary( + 'OpenSSH server configuration needs to be modified to contain Include directive ' +- 'for the RHEL9 to work properly and integrate with the other parts of the OS. ' ++ 'for the target system to work properly and integrate with the other parts of the OS. ' + 'The following snippet will be added to the /etc/ssh/sshd_config during the ' + 'ApplicationsPhase: `Include /etc/ssh/sshd_config.d/*.conf`' + ), +diff --git a/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/libraries/opensshsubsystemsftp.py b/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/libraries/opensshsubsystemsftp.py +index 3264a8de..306fef7e 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/libraries/opensshsubsystemsftp.py ++++ b/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/libraries/opensshsubsystemsftp.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + + +@@ -32,9 +33,10 @@ def process(openssh_messages): + reporting.create_report([ + reporting.Title('OpenSSH configured without SFTP subsystem'), + reporting.Summary( +- 'The RHEL9 is changing the default SCP behaviour to use SFTP internally ' ++ 'The {target_distro} 9 is changing the default SCP behaviour to use SFTP internally ' + 'so not having SFTP server enabled can prevent interoperability and break existing ' +- 'scripts on other systems updated to RHEL9 to copy files to or from this machine.' ++ 'scripts on other systems updated to {target_distro} 9 to copy files to or from ' ++ 'this machine.'.format_map(DISTRO_REPORT_NAMES) + ), + reporting.Remediation( + hint='Add the following line to the /etc/ssh/sshd_config to enable SFTP server: ' +diff --git a/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/tests/test_opensshsubsystemsftp.py b/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/tests/test_opensshsubsystemsftp.py +index 4e3c2ace..4ffe1112 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/tests/test_opensshsubsystemsftp.py ++++ b/repos/system_upgrade/el8toel9/actors/opensshsubsystemsftp/tests/test_opensshsubsystemsftp.py +@@ -2,6 +2,7 @@ import pytest + + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.actor import opensshsubsystemsftp ++from leapp.libraries.common import distro + from leapp.models import OpenSshConfig, Report + + +@@ -17,7 +18,9 @@ def test_no_config(current_actor_context): + (True, 'internal-sftp', False), + (True, '/usr/libexec/openssh/sftp-server', False) + ]) +-def test_subsystem(current_actor_context, modified, subsystem, expected_report): ++def test_subsystem(monkeypatch, current_actor_context, modified, subsystem, expected_report): ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ + conf = OpenSshConfig( + modified=modified, + permit_root_login=[], +diff --git a/repos/system_upgrade/el8toel9/actors/postgresqlcheck/libraries/postgresqlcheck.py b/repos/system_upgrade/el8toel9/actors/postgresqlcheck/libraries/postgresqlcheck.py +index 1cc5362d..0952e3b5 100644 +--- a/repos/system_upgrade/el8toel9/actors/postgresqlcheck/libraries/postgresqlcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/postgresqlcheck/libraries/postgresqlcheck.py +@@ -1,27 +1,9 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM + +-# Summary for postgresql-server report +-report_server_inst_summary = ( +- 'PostgreSQL server component will be upgraded. Since RHEL-9 includes' +- ' PostgreSQL server 13 by default, which is incompatible with 9.6, 10 and 12' +- ' included in RHEL-8, in those cases, it is necessary to proceed with additional steps' +- ' for the complete upgrade of the PostgreSQL data.' +- 'If the database has already been upgraded, meaning the system is already using PostgreSQL 13,' +- ' then no further actions are required.' +-) +- +-report_server_inst_hint = ( +- 'Back up your data before proceeding with the upgrade' +- ' and follow steps in the documentation section "Migrating to a RHEL 9 version of PostgreSQL"' +- ' after the upgrade.' +-) +- +-# Link URL for postgresql-server report +-report_server_inst_link_url = 'https://access.redhat.com/articles/6654721' +- + + def _report_server_installed(): + """ +@@ -31,16 +13,37 @@ def _report_server_installed(): + installation, warn them about necessary additional steps, and + redirect them to online documentation for the upgrade process. + """ +- reporting.create_report([ +- reporting.Title('PostgreSQL (postgresql-server) has been detected on your system'), +- reporting.Summary(report_server_inst_summary), +- reporting.Severity(reporting.Severity.MEDIUM), +- reporting.Groups([reporting.Groups.SERVICES]), +- reporting.ExternalLink(title='Migrating to a RHEL 9 version of PostgreSQL', +- url=report_server_inst_link_url), +- reporting.RelatedResource('package', 'postgresql-server'), +- reporting.Remediation(hint=report_server_inst_hint), +- ]) ++ summary = ( ++ 'PostgreSQL server component will be upgraded. Since {target_distro} 9' ++ ' includes PostgreSQL server 13 by default, which is incompatible with 9.6,' ++ ' 10 and 12 included in {source_distro} 8, in those cases, it is necessary' ++ ' to proceed with additional steps for the complete upgrade of the PostgreSQL' ++ ' data. If the database has already been upgraded, meaning the system is' ++ ' already using PostgreSQL 13, then no further actions are required.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ++ hint = ( ++ 'Back up your data before proceeding with the upgrade' ++ ' and follow steps in the documentation section "Migrating to a RHEL 9 version of PostgreSQL"' ++ ' after the upgrade.' ++ ) ++ ++ reporting.create_report( ++ [ ++ reporting.Title( ++ "PostgreSQL (postgresql-server) has been detected on your system" ++ ), ++ reporting.Summary(summary), ++ reporting.Severity(reporting.Severity.MEDIUM), ++ reporting.Groups([reporting.Groups.SERVICES]), ++ reporting.ExternalLink( ++ title="Migrating to a RHEL 9 version of PostgreSQL", ++ url='https://access.redhat.com/articles/6654721', ++ ), ++ reporting.RelatedResource("package", "postgresql-server"), ++ reporting.Remediation(hint=hint), ++ ] ++ ) + + + def report_installed_packages(_context=api): +diff --git a/repos/system_upgrade/el9toel10/actors/check_default_initramfs/libraries/check_default_initramfs.py b/repos/system_upgrade/el9toel10/actors/check_default_initramfs/libraries/check_default_initramfs.py +index 098b5fde..706eddc8 100644 +--- a/repos/system_upgrade/el9toel10/actors/check_default_initramfs/libraries/check_default_initramfs.py ++++ b/repos/system_upgrade/el9toel10/actors/check_default_initramfs/libraries/check_default_initramfs.py +@@ -2,6 +2,7 @@ import os + + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import DefaultInitramfsInfo + +@@ -14,15 +15,17 @@ def check_default_initramfs(): + + if 'network-legacy' in default_initramfs_info.used_dracut_modules: + summary = ( +- f'Initramfs ({default_initramfs_info.path}) of the default boot entry uses dracut ' ++ 'Initramfs ({initramfs_path}) of the default boot entry uses dracut ' + 'modules that are missing on the target system. This could cause a fatal ' + 'failure during the upgrade, resulting in unbootable system as ' + 'the missing dracut module could prevent creation of the required target ' + 'initramfs.\n\n' + 'Namely, the legacy-network dracut module is used on this system, which ' +- 'could originate from older system installations. The problem is typical ' +- 'for RHEL 7 and early RHEL 8 systems that were in-place-upgraded to RHEL 9.' +- ) ++ 'could originate from older system installations. ' ++ 'The problem is typical for {source_distro} 7 and early {source_distro} 8 ' ++ 'systems that were in-place-upgraded to {source_distro} 9.' ++ ).format(**DISTRO_REPORT_NAMES, initramfs_path=default_initramfs_info.path) ++ + remediation_hint = ( + 'Remove the dracut config file which adds the `network-legacy` dracut module. ' + 'Then rebuild existing initramfs images to remove the dracut module from them.' +diff --git a/repos/system_upgrade/el9toel10/actors/checkoldxfs/libraries/checkoldxfs.py b/repos/system_upgrade/el9toel10/actors/checkoldxfs/libraries/checkoldxfs.py +index 0069ae7f..8b35744b 100644 +--- a/repos/system_upgrade/el9toel10/actors/checkoldxfs/libraries/checkoldxfs.py ++++ b/repos/system_upgrade/el9toel10/actors/checkoldxfs/libraries/checkoldxfs.py +@@ -1,10 +1,9 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import XFSInfoFacts + +-RHEL_9_TO_10_BACKUP_RESTORE_LINK = 'https://red.ht/rhel_9_to_10_backup_restore_xfs' +- + FMT_LIST_SEPARATOR = '\n - ' + + +@@ -71,14 +70,16 @@ def _inhibit_upgrade(invalid_bigtime, invalid_crc): + def _report_bigtime(invalid_bigtime): + title = 'Detected XFS filesystems without bigtime feature.' + summary = ( +- 'The XFS v5 filesystem format introduced the "bigtime" feature in RHEL 9,' +- ' to support timestamps beyond the year 2038. XFS filesystems that' ++ 'The XFS v5 filesystem format introduced the "bigtime" feature in' ++ ' {distro} 9, to support timestamps beyond the year 2038. XFS filesystems that' + ' do not have the "bigtime" feature enabled remain vulnerable to timestamp' + ' overflow issues. It is recommended to enable this feature on all' + ' XFS filesystems to ensure long-term compatibility and prevent potential' + ' failures.' +- ' Following XFS file systems have not enabled the "bigtime" feature:{}' +- .format(''.join(_formatted_list_output(invalid_bigtime))) ++ ' Following XFS file systems have not enabled the "bigtime" feature:{fs_list}'.format( ++ distro=DISTRO_REPORT_NAMES.target, ++ fs_list=''.join(_formatted_list_output(invalid_bigtime)) ++ ) + ) + + # NOTE(pstodulk): This will affect any system which upgraded from RHEL 8 so +diff --git a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py +index 0a38ace3..6ae41be2 100644 +--- a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py ++++ b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import KernelCmdline + +@@ -30,10 +31,12 @@ def process(): + remediation_cmd_args.append('systemd.legacy_systemd_cgroup_controller') + + summary = ( +- "Leapp detected cgroups-v1 is enabled on the system." +- " The support of cgroups-v1 was deprecated in RHEL 9 and is removed in RHEL 10." +- " Software requiring cgroups-v1 might not work correctly or at all on RHEL 10." +- ) ++ "Leapp detected cgroups-v1 is enabled on the system. The support of" ++ " cgroups-v1 was deprecated in {source_distro} 9 and is removed in" ++ " {target_distro} 10. Software requiring cgroups-v1 might not work" ++ " correctly or at all on {target_distro} 10." ++ ).format_map(DISTRO_REPORT_NAMES) ++ + reporting.create_report( + [ + reporting.Title("cgroups-v1 enabled on the system"), +diff --git a/repos/system_upgrade/el9toel10/actors/krb5conf/checkkrb5conf/libraries/checkkrb5conf.py b/repos/system_upgrade/el9toel10/actors/krb5conf/checkkrb5conf/libraries/checkkrb5conf.py +index 9feeb74e..406141cd 100644 +--- a/repos/system_upgrade/el9toel10/actors/krb5conf/checkkrb5conf/libraries/checkkrb5conf.py ++++ b/repos/system_upgrade/el9toel10/actors/krb5conf/checkkrb5conf/libraries/checkkrb5conf.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import OutdatedKrb5conf + +@@ -22,7 +23,8 @@ def process(): + reporting.Title('Unmanaged MIT krb5 configuration file(s) will be ' + 'updated to point to the new X.509 CA bundle file'), + reporting.Summary( +- 'On RHEL 10, the location of the reference X.509 CA bundle ' ++ f'On {DISTRO_REPORT_NAMES.target} 10, ' ++ 'the location of the reference X.509 CA bundle ' + 'file was modified. The following unmanaged MIT krb5 ' + 'configuration files have to be updated to point to the new ' + 'bundle file:' + __human_readable_list(msg.unmanaged_files)), +@@ -36,7 +38,8 @@ def process(): + reporting.Title('RPM-provided MIT krb5 configuration file(s) are ' + 'pointing to outdated X.509 CA bundle file'), + reporting.Summary( +- 'On RHEL 10, the location of the reference X.509 CA bundle ' ++ f'On {DISTRO_REPORT_NAMES.target} 10, ' ++ 'the location of the reference X.509 CA bundle ' + 'file was modified. Some MIT krb5 configuration files on this ' + 'system are pointing to the old bundle file, but are provided ' + 'by third-party RPMs. You must make sure these third-party ' +diff --git a/repos/system_upgrade/el9toel10/actors/libdbcheck/libraries/libdbcheck.py b/repos/system_upgrade/el9toel10/actors/libdbcheck/libraries/libdbcheck.py +index 84c03ef0..0eb773b0 100644 +--- a/repos/system_upgrade/el9toel10/actors/libdbcheck/libraries/libdbcheck.py ++++ b/repos/system_upgrade/el9toel10/actors/libdbcheck/libraries/libdbcheck.py +@@ -1,27 +1,9 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM + +-# Summary for libdb report +-report_libdb_inst_summary = ( +- 'Libdb was marked as deprecated in RHEL-9 and in RHEL-10 is not included anymore.' +- ' There are a couple of alternatives in RHEL-10; the applications that' +- ' depend on libdb will not work. Such applications must implement another' +- ' type of backend storage. And migrate existing data to the new database format.' +-) +- +-report_libdb_inst_hint = ( +- 'Back up your data before proceeding with the data upgrade/migration.' +- ' For the conversion, the tool db_converter from the libdb-utils' +- ' rpm could be used. This database format conversion must be performed' +- ' before the system upgrade. The db_converter is not available in RHEL 10' +- ' systems. For more information, see the provided article.' +-) +- +-# Link URL for libdb report +-report_libdb_inst_link_url = 'https://access.redhat.com/articles/7099256' +- + + def _report_libdb_installed(): + """ +@@ -31,16 +13,32 @@ def _report_libdb_installed(): + installation, warn them about the lack of libdb support in RHEL 10, and + redirect them to online documentation for the migration process. + """ ++ summary = ( ++ 'Libdb was marked as deprecated in {source_distro} 9 and in' ++ ' {target_distro} 10 is not included anymore.' ++ ' There are a couple of alternatives in {target_distro} 10; the applications that' ++ ' depend on libdb will not work. Such applications must implement another' ++ ' type of backend storage. And migrate existing data to the new database format.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ++ hint_text = ( ++ 'Back up your data before proceeding with the data upgrade/migration.' ++ ' For the conversion, the tool db_converter from the libdb-utils' ++ ' rpm could be used. This database format conversion must be performed' ++ ' before the system upgrade. The db_converter is not available in' ++ ' {target_distro} 10 systems. For more information, see the provided article.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ + reporting.create_report([ + reporting.Title('Berkeley DB (libdb) has been detected on your system'), +- reporting.Summary(report_libdb_inst_summary), ++ reporting.Summary(summary), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.ExternalLink(title='Migrating to a RHEL 10 without libdb', +- url=report_libdb_inst_link_url), ++ url='https://access.redhat.com/articles/7099256'), + reporting.RelatedResource('package', 'libdb'), +- reporting.Remediation(hint=report_libdb_inst_hint), +- ]) ++ reporting.Remediation(hint=hint_text), ++ ]) + + + def report_installed_packages(_context=api): +diff --git a/repos/system_upgrade/el9toel10/actors/mariadbcheck/libraries/mariadbcheck.py b/repos/system_upgrade/el9toel10/actors/mariadbcheck/libraries/mariadbcheck.py +index f5092a73..ac14b13d 100644 +--- a/repos/system_upgrade/el9toel10/actors/mariadbcheck/libraries/mariadbcheck.py ++++ b/repos/system_upgrade/el9toel10/actors/mariadbcheck/libraries/mariadbcheck.py +@@ -1,27 +1,9 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM + +-# Summary for mariadb-server report +-report_server_inst_summary = ( +- 'MariaDB server component will be upgraded. Since RHEL-10 includes' +- ' MariaDB server 10.11 by default, which is incompatible with 10.5' +- ' included in RHEL-9 as default stream, it is necessary to proceed with' +- ' additional steps for the complete upgrade of the MariaDB data.' +-) +- +-report_server_inst_hint = ( +- 'Back up your data before proceeding with the upgrade' +- ' and follow steps in the documentation section "Migrating to a RHEL 10 version of MariaDB"' +- ' after the upgrade. If the database has already been upgraded,' +- ' meaning the system is already using MariaDB 10.11 then no further' +- ' actions are required.' +-) +- +-# Link URL for mariadb-server report +-report_server_inst_link_url = 'https://access.redhat.com/articles/7097551' +- + + def _report_server_installed(): + """ +@@ -31,16 +13,31 @@ def _report_server_installed(): + installation, warn them about necessary additional steps, and + redirect them to online documentation for the upgrade process. + """ ++ summary = ( ++ 'MariaDB server component will be upgraded.' ++ ' Since {target_distro} 10 includes MariaDB server 10.11 by default,' ++ ' which is incompatible with 10.5 included in {source_distro} 9 as default stream,' ++ ' it is necessary to proceed with additional steps for the complete upgrade of the MariaDB data.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ++ hint = ( ++ 'Back up your data before proceeding with the upgrade and follow' ++ ' steps in the documentation section "Migrating to a RHEL 10 version of' ++ ' MariaDB" after the upgrade. If the database has already been' ++ ' upgraded, meaning the system is already using MariaDB 10.11 then no' ++ ' further actions are required.' ++ ) ++ + reporting.create_report([ + reporting.Title('MariaDB (mariadb-server) has been detected on your system'), +- reporting.Summary(report_server_inst_summary), ++ reporting.Summary(summary), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.ExternalLink(title='Migrating to a RHEL 10 version of MariaDB', +- url=report_server_inst_link_url), ++ url='https://access.redhat.com/articles/7097551'), + reporting.RelatedResource('package', 'mariadb-server'), +- reporting.Remediation(hint=report_server_inst_hint), +- ]) ++ reporting.Remediation(hint=hint), ++ ]) + + + def report_installed_packages(_context=api): +diff --git a/repos/system_upgrade/el9toel10/actors/motifcheck/libraries/motifcheck.py b/repos/system_upgrade/el9toel10/actors/motifcheck/libraries/motifcheck.py +index ea69057e..ea00406f 100644 +--- a/repos/system_upgrade/el9toel10/actors/motifcheck/libraries/motifcheck.py ++++ b/repos/system_upgrade/el9toel10/actors/motifcheck/libraries/motifcheck.py +@@ -1,22 +1,8 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.models import DistributionSignedRPM + +-# Summary for motif report +-report_motif_inst_summary = ( +- 'The Motif package has been detected on your system. Motif is no longer available in RHEL 10.' +- ' Applications that depend on Motif will not work after the upgrade.' +- ' You will need to either migrate to an alternative GUI toolkit (such as GTK or Qt)' +- ' or maintain the Motif package through alternative means.' +-) +- +-report_motif_inst_hint = ( +- 'Consider migrating applications to a modern GUI toolkit before proceeding with the upgrade.' +-) +- +-# Link URL for motif report +-report_motif_inst_link_url = 'https://red.ht/rhel-10-removed-features-graphics-infrastructures' +- + + def _report_motif_installed(): + """ +@@ -26,16 +12,28 @@ def _report_motif_installed(): + installation, warn them about the lack of motif support in RHEL 10, and + redirect them to online documentation for the migration process. + """ ++ summary = ( ++ 'The Motif package has been detected on your system. Motif is no longer' ++ ' available in {target_distro} 10. Applications that depend on Motif' ++ ' will not work after the upgrade. You will need to either migrate to' ++ ' an alternative GUI toolkit (such as GTK or Qt) or maintain the Motif' ++ ' package through alternative means.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ + reporting.create_report([ + reporting.Title('Motif has been detected on your system'), +- reporting.Summary(report_motif_inst_summary), ++ reporting.Summary(summary), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SERVICES]), +- reporting.ExternalLink(title='RHEL 10 Removed Features - Graphics Infrastructures', +- url=report_motif_inst_link_url), ++ reporting.ExternalLink( ++ title='RHEL 10 Removed Features - Graphics Infrastructures', ++ url='https://red.ht/rhel-10-removed-features-graphics-infrastructures' ++ ), + reporting.RelatedResource('package', 'motif'), +- reporting.Remediation(hint=report_motif_inst_hint), +- ]) ++ reporting.Remediation( ++ hint='Consider migrating applications to a modern GUI toolkit before proceeding with the upgrade.' ++ ), ++ ]) + + + def report_installed_packages(): +diff --git a/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/libraries/checkmysql.py b/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/libraries/checkmysql.py +index 7ab07e8c..19a36354 100644 +--- a/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/libraries/checkmysql.py ++++ b/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/libraries/checkmysql.py +@@ -2,6 +2,7 @@ from typing import TYPE_CHECKING + + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + + if TYPE_CHECKING: +@@ -32,14 +33,16 @@ def _generate_mysql_present_report() -> None: + """ + reporting.create_report([ + reporting.Title('Manual migration of data from MySQL database might be needed'), +- reporting.Summary(( +- 'MySQL server component will be upgraded. ' +- 'Since RHEL-10 includes MySQL server 8.4 by default, ' +- 'it might be necessary to proceed with additional steps after ' +- 'RHEL upgrade is completed. In simple setups MySQL server should ' +- 'automatically upgrade all data on first start, but in more ' +- 'complicated setups manual intervention might be needed.' +- )), ++ reporting.Summary( ++ ( ++ 'MySQL server component will be upgraded. ' ++ 'Since {target_distro} 10 includes MySQL server 8.4 by default, ' ++ 'it might be necessary to proceed with additional steps after ' ++ 'the upgrade is completed. In simple setups MySQL server should ' ++ 'automatically upgrade all data on first start, but in more ' ++ 'complicated setups manual intervention might be needed.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.ExternalLink(title='Migrating MySQL databases from RHEL 9 to RHEL 10', +@@ -51,7 +54,7 @@ def _generate_mysql_present_report() -> None: + '"Migrating MySQL databases from RHEL 9 to RHEL 10" ' + 'with up to date recommended steps before and after the upgrade.' + )), +- ]) ++ ]) + + + def _generate_deprecated_config_report(found_options: list, +diff --git a/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/tests/test_checkmysql.py b/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/tests/test_checkmysql.py +index 84bcf859..b007f30a 100644 +--- a/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/tests/test_checkmysql.py ++++ b/repos/system_upgrade/el9toel10/actors/mysql/checkmysql/tests/test_checkmysql.py +@@ -3,7 +3,7 @@ import pytest + from leapp import reporting + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.actor import checkmysql +-from leapp.libraries.common.testutils import create_report_mocked, logger_mocked ++from leapp.libraries.common.testutils import create_report_mocked, CurrentActorMocked, logger_mocked + from leapp.libraries.stdlib import api + from leapp.models import MySQLConfiguration + +@@ -42,6 +42,7 @@ def test_process_no_deprecated(monkeypatch): + removed_options=[], + removed_arguments=[]) + ++ monkeypatch.setattr(api, "current_actor", CurrentActorMocked()) + monkeypatch.setattr(reporting, "create_report", create_report_mocked()) + monkeypatch.setattr(api, 'consume', consume_mocked) + +@@ -57,6 +58,7 @@ def test_process_deprecated(monkeypatch): + removed_options=['avoid_temporal_upgrade', '--old'], + removed_arguments=['--language']) + ++ monkeypatch.setattr(api, "current_actor", CurrentActorMocked()) + monkeypatch.setattr(reporting, "create_report", create_report_mocked()) + monkeypatch.setattr(api, 'consume', consume_mocked) + +diff --git a/repos/system_upgrade/el9toel10/actors/networkdeprecations/actor.py b/repos/system_upgrade/el9toel10/actors/networkdeprecations/actor.py +index ccafc1ee..337ea915 100644 +--- a/repos/system_upgrade/el9toel10/actors/networkdeprecations/actor.py ++++ b/repos/system_upgrade/el9toel10/actors/networkdeprecations/actor.py +@@ -2,6 +2,7 @@ import os + + from leapp import reporting + from leapp.actors import Actor ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.models import IfCfg, NetworkManagerConfig, Report + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + +@@ -30,9 +31,12 @@ class CheckNetworkDeprecations9to10(Actor): + @staticmethod + def report_dhclient(): + title = 'Deprecated DHCP plugin configured' +- summary = ('NetworkManager is configured to use the "dhclient" DHCP module.' +- ' In Red Hat Enterprise Linux 10, this setting will be ignored' +- ' along with any dhcp-client specific configuration.') ++ summary = ( ++ 'NetworkManager is configured to use the "dhclient" DHCP module.' ++ ' In {target_distro} 10, this setting will be ignored' ++ ' along with any dhcp-client specific configuration.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ + remediation = ('Remove "dhcp=dhclient" line from "[main]" section from all' + ' configuration files in "/etc/NetworkManager". Review' + ' configuration in "/etc/dhcp", which will be ignored.') +@@ -53,12 +57,15 @@ class CheckNetworkDeprecations9to10(Actor): + reporting.Title('Legacy network configuration with policy routing rules found'), + reporting.Summary( + 'Network configuration files in "ifcfg" format are present accompanied' +- ' by legacy routing rules. In Red Hat Enterprise Linux 10, support' ++ ' by legacy routing rules. In {target_distro} 10, support' + ' for these files is no longer enabled and the configuration will be' + ' ignored. Legacy routing rules are not supported by NetworkManager' + ' natively and therefore can not be migrated automatically.' +- ' The following configuration files were found:{}' +- .format(''.join(_formatted_list_output(conn.values()))) ++ ' The following configuration files were found:{files}' ++ .format( ++ files=''.join(_formatted_list_output(conn.values())), ++ target_distro=DISTRO_REPORT_NAMES.target ++ ) + ), + reporting.Remediation(hint='Replace the routing rules with equivalent' + ' "ipv4.routing-rules" or "ipv6.routing-rules" properties,' +@@ -81,7 +88,6 @@ class CheckNetworkDeprecations9to10(Actor): + reporting.RelatedResource('package', 'NetworkManager'), + reporting.RelatedResource('package', 'NetworkManager-dispatcher-routing-rules'), + ] + [reporting.RelatedResource('file', file) for file in conn.values()]) +- pass + + @staticmethod + def report_ifcfg_leftover(conn): +@@ -110,9 +116,12 @@ class CheckNetworkDeprecations9to10(Actor): + reporting.Title('Legacy network configuration found'), + reporting.Summary( + 'Network configuration files in legacy "ifcfg" format are present.' +- 'In Red Hat Enterprise Linux 10, support for these files is no longer' ++ 'In {target_distro} 10, support for these files is no longer' + ' enabled and the configuration will be ignored. The following files' +- ' were found:{}'.format(''.join(_formatted_list_output(conn.values()))) ++ ' were found:{conns}'.format( ++ conns=''.join(_formatted_list_output(conn.values())), ++ target_distro=DISTRO_REPORT_NAMES.target, ++ ) + ), + reporting.Remediation( + hint='Convert the configuration into NetworkManager native "keyfile" format.', +diff --git a/repos/system_upgrade/el9toel10/actors/networkdeprecations/tests/unit_test_networkdeprecations_9to10.py b/repos/system_upgrade/el9toel10/actors/networkdeprecations/tests/unit_test_networkdeprecations_9to10.py +index e84b99ce..9005790b 100644 +--- a/repos/system_upgrade/el9toel10/actors/networkdeprecations/tests/unit_test_networkdeprecations_9to10.py ++++ b/repos/system_upgrade/el9toel10/actors/networkdeprecations/tests/unit_test_networkdeprecations_9to10.py +@@ -1,9 +1,16 @@ + import pytest + ++from leapp.libraries.common import distro + from leapp.models import IfCfg, NetworkManagerConfig, Report + from leapp.utils.report import is_inhibitor + + ++@pytest.fixture(autouse=True) ++def common_mocks(monkeypatch): ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ ++ + def test_dhcp_dhclient(current_actor_context): + current_actor_context.feed(NetworkManagerConfig(dhcp='dhclient')) + current_actor_context.run() +diff --git a/repos/system_upgrade/el9toel10/actors/opensslenginescheck/libraries/opensslenginescheck.py b/repos/system_upgrade/el9toel10/actors/opensslenginescheck/libraries/opensslenginescheck.py +index 00edc1da..06819162 100644 +--- a/repos/system_upgrade/el9toel10/actors/opensslenginescheck/libraries/opensslenginescheck.py ++++ b/repos/system_upgrade/el9toel10/actors/opensslenginescheck/libraries/opensslenginescheck.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + + FMT_LIST_SEPARATOR = '\n - ' +@@ -110,11 +111,14 @@ def check_openssl_engines(config): + reporting.Summary( + 'OpenSSL engines are deprecated since OpenSSL version 3.0' + ' and they are no longer supported nor available on the target' +- ' RHEL 10 system. Any applications depending on OpenSSL engines' +- ' might not work correctly on the target system and should be configured' +- ' to use OpenSSL providers instead.' +- ' The following OpenSSL engines are configured inside the /etc/pki/tls/openssl.cnf file:{}' +- .format(''.join(_formatted_list_output(enabled_engines))) ++ ' {target} 10 system. Any applications depending on OpenSSL engines' ++ ' might not work correctly on the target system and should be' ++ ' configured to use OpenSSL providers instead.' ++ ' The following OpenSSL engines are configured inside the' ++ ' /etc/pki/tls/openssl.cnf file:{engines}'.format( ++ target=DISTRO_REPORT_NAMES.target, ++ engines=''.join(_formatted_list_output(enabled_engines)), ++ ) + ), + reporting.Remediation(hint=( + 'After the upgrade configure your system and applications' +diff --git a/repos/system_upgrade/el9toel10/actors/opensslenginescheck/tests/component_test_opensslenginescheck.py b/repos/system_upgrade/el9toel10/actors/opensslenginescheck/tests/component_test_opensslenginescheck.py +index e5ed7b25..afb1e5a2 100644 +--- a/repos/system_upgrade/el9toel10/actors/opensslenginescheck/tests/component_test_opensslenginescheck.py ++++ b/repos/system_upgrade/el9toel10/actors/opensslenginescheck/tests/component_test_opensslenginescheck.py +@@ -1,3 +1,4 @@ ++from leapp.libraries.common import distro + from leapp.models import OpenSslConfig, OpenSslConfigBlock, OpenSslConfigPair, Report + + +@@ -93,7 +94,9 @@ def test_actor_execution_default_modified(current_actor_context): + assert not current_actor_context.consume(Report) + + +-def test_actor_execution_other_engine_modified(current_actor_context): ++def test_actor_execution_other_engine_modified(current_actor_context, monkeypatch): ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') + # default, but removing contents unrelated for the checks + current_actor_context.feed( + OpenSslConfig( +diff --git a/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/libraries/checkpamuserdb.py b/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/libraries/checkpamuserdb.py +index 05cc71a9..58b47f58 100644 +--- a/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/libraries/checkpamuserdb.py ++++ b/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/libraries/checkpamuserdb.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import PamUserDbLocation + +@@ -15,10 +16,15 @@ def process(): + reporting.create_report([ + reporting.Title('pam_userdb databases will be converted to GDBM'), + reporting.Summary( +- 'On RHEL 10, GDMB is used by pam_userdb as it\'s backend database,' ++ 'On {target_distro} 10, GDMB is used by pam_userdb as it\'s backend database,' + ' replacing BerkeleyDB. Existing pam_userdb databases will be' + ' converted to GDBM. The following databases will be converted:' +- '{sep}{locations}'.format(sep=FMT_LIST_SEPARATOR, locations=FMT_LIST_SEPARATOR.join(msg.locations))), ++ '{sep}{locations}'.format( ++ sep=FMT_LIST_SEPARATOR, ++ locations=FMT_LIST_SEPARATOR.join(msg.locations), ++ target_distro=DISTRO_REPORT_NAMES.target, ++ ) ++ ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SECURITY, reporting.Groups.AUTHENTICATION]) + ]) +diff --git a/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/tests/test_checkpamuserdb.py b/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/tests/test_checkpamuserdb.py +index 2e11106b..1f81fb26 100644 +--- a/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/tests/test_checkpamuserdb.py ++++ b/repos/system_upgrade/el9toel10/actors/pamuserdb/checkpamuserdb/tests/test_checkpamuserdb.py +@@ -3,6 +3,7 @@ import pytest + from leapp import reporting + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.actor import checkpamuserdb ++from leapp.libraries.common import distro + from leapp.libraries.common.testutils import create_report_mocked, logger_mocked + from leapp.libraries.stdlib import api + from leapp.models import PamUserDbLocation +@@ -38,6 +39,8 @@ def test_process_locations(monkeypatch): + + monkeypatch.setattr(reporting, "create_report", create_report_mocked()) + monkeypatch.setattr(api, 'consume', consume_mocked) ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') + + checkpamuserdb.process() + assert reporting.create_report.called == 1 +diff --git a/repos/system_upgrade/el9toel10/actors/postgresqlcheck/libraries/postgresqlcheck.py b/repos/system_upgrade/el9toel10/actors/postgresqlcheck/libraries/postgresqlcheck.py +index 7186b440..25689433 100644 +--- a/repos/system_upgrade/el9toel10/actors/postgresqlcheck/libraries/postgresqlcheck.py ++++ b/repos/system_upgrade/el9toel10/actors/postgresqlcheck/libraries/postgresqlcheck.py +@@ -1,27 +1,9 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import DistributionSignedRPM + +-# Summary for postgresql-server report +-report_server_inst_summary = ( +- 'PostgreSQL server component will be upgraded. Since RHEL-10 includes' +- ' PostgreSQL server 16 by default, which is incompatible with 13 and 15' +- ' included in RHEL-9, in those cases, it is necessary to proceed with additional steps' +- ' for the complete upgrade of the PostgreSQL data.' +- 'If the database has already been upgraded, meaning the system is already using PostgreSQL 16,' +- ' then no further actions are required.' +-) +- +-report_server_inst_hint = ( +- 'Back up your data before proceeding with the upgrade' +- ' and follow steps in the documentation section "Migrating to a RHEL 10 version of PostgreSQL"' +- ' after the upgrade.' +-) +- +-# Link URL for postgresql-server report +-report_server_inst_link_url = 'https://access.redhat.com/articles/7097228' +- + + def _report_server_installed(): + """ +@@ -31,16 +13,34 @@ def _report_server_installed(): + installation, warn them about necessary additional steps, and + redirect them to online documentation for the upgrade process. + """ ++ ++ summary = ( ++ 'PostgreSQL server component will be upgraded. Since {target_distro} 10 includes' ++ ' PostgreSQL server 16 by default, which is incompatible with 13 and 15' ++ ' included in {source_distro} 9, in those cases, it is necessary to' ++ ' proceed with additional steps for the complete upgrade of the PostgreSQL data.' ++ ' If the database has already been upgraded, meaning the system is' ++ ' already using PostgreSQL 16, then no further actions are required.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ ++ hint_text = ( ++ 'Back up your data before proceeding with the upgrade' ++ ' and follow steps in the documentation section "Migrating to a RHEL 10 version of PostgreSQL"' ++ ' after the upgrade.' ++ ) ++ + reporting.create_report([ +- reporting.Title('PostgreSQL (postgresql-server) has been detected on your system'), +- reporting.Summary(report_server_inst_summary), +- reporting.Severity(reporting.Severity.MEDIUM), +- reporting.Groups([reporting.Groups.SERVICES]), +- reporting.ExternalLink(title='Migrating to a RHEL 10 version of PostgreSQL', +- url=report_server_inst_link_url), +- reporting.RelatedResource('package', 'postgresql-server'), +- reporting.Remediation(hint=report_server_inst_hint), +- ]) ++ reporting.Title('PostgreSQL (postgresql-server) has been detected on your system'), ++ reporting.Summary(summary), ++ reporting.Severity(reporting.Severity.MEDIUM), ++ reporting.Groups([reporting.Groups.SERVICES]), ++ reporting.ExternalLink( ++ title='Migrating to a RHEL 10 version of PostgreSQL', ++ url='https://access.redhat.com/articles/7097228', ++ ), ++ reporting.RelatedResource('package', 'postgresql-server'), ++ reporting.Remediation(hint=hint_text), ++ ]) + + + def report_installed_packages(_context=api): +diff --git a/repos/system_upgrade/el9toel10/actors/xorgcheck/libraries/xorgcheck.py b/repos/system_upgrade/el9toel10/actors/xorgcheck/libraries/xorgcheck.py +index 13092957..e70b4d5c 100644 +--- a/repos/system_upgrade/el9toel10/actors/xorgcheck/libraries/xorgcheck.py ++++ b/repos/system_upgrade/el9toel10/actors/xorgcheck/libraries/xorgcheck.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.models import DistributionSignedRPM + +@@ -16,21 +17,6 @@ _XORG_PACKAGES = [ + # Separator for list formatting in reports + FMT_LIST_SEPARATOR = '\n - ' + +-# Summary template for Xorg report +-_report_xorg_inst_summary_template = ( +- 'Xorg server packages have been detected on your system. The Xorg server is no longer available ' +- 'in RHEL 10. Applications and services that depend on Xorg server packages will not work ' +- 'after the upgrade. Migrate to Wayland or maintain the Xorg packages through ' +- 'alternative means. The following Xorg server packages have been detected and are not available in RHEL 10:{}{}' +-) +- +-_report_xorg_inst_hint = ( +- 'Consider migrating to Wayland before proceeding with the upgrade.' +-) +- +-# Link URL for Xorg report +-_report_xorg_inst_link_url = 'https://red.ht/rhel-10-removed-features-graphics-infrastructures' +- + + def _report_xorg_installed(packages): + """ +@@ -43,15 +29,25 @@ def _report_xorg_installed(packages): + :param packages: List of installed Xorg package names + :type packages: list + """ +- summary = _report_xorg_inst_summary_template.format(FMT_LIST_SEPARATOR, FMT_LIST_SEPARATOR.join(packages)) ++ summary = ( ++ "Xorg server packages have been detected on your system. The Xorg server is no longer available " ++ "in {distro} 10. Applications and services that depend on Xorg server packages will " ++ "not work after the upgrade. Migrate to Wayland or maintain the Xorg packages through alternative means. " ++ "The following Xorg server packages have been detected and are not available in {distro} 10:{sep}{list}" ++ ).format( ++ distro=DISTRO_REPORT_NAMES.target, ++ sep=FMT_LIST_SEPARATOR, ++ list=FMT_LIST_SEPARATOR.join(packages), ++ ) ++ + reporting.create_report([ + reporting.Title('Xorg server packages have been detected on your system'), + reporting.Summary(summary), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SERVICES]), + reporting.ExternalLink(title='RHEL 10 Removed Features - Graphics Infrastructures', +- url=_report_xorg_inst_link_url), +- reporting.Remediation(hint=_report_xorg_inst_hint), ++ url='https://red.ht/rhel-10-removed-features-graphics-infrastructures'), ++ reporting.Remediation(hint='Consider migrating to Wayland before proceeding with the upgrade.'), + ] + [reporting.RelatedResource('package', pkg) for pkg in packages]) + + +-- +2.53.0 + diff --git a/0011-checkblacklistca-Respect-distro-name-in-reports.patch b/0011-checkblacklistca-Respect-distro-name-in-reports.patch new file mode 100644 index 0000000..4067785 --- /dev/null +++ b/0011-checkblacklistca-Respect-distro-name-in-reports.patch @@ -0,0 +1,86 @@ +From f6838df00e3be7d8beec99bd9448ed47c7720853 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 18:25:09 +0100 +Subject: [PATCH 11/44] checkblacklistca: Respect distro name in reports + +Jira: RHEL-130950 +--- + .../libraries/checkblacklistca.py | 28 +++++++++++++------ + .../tests/component_test_checkblacklistca.py | 9 ++++++ + 2 files changed, 29 insertions(+), 8 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/checkblacklistca/libraries/checkblacklistca.py b/repos/system_upgrade/el8toel9/actors/checkblacklistca/libraries/checkblacklistca.py +index 53b912b8..635b3640 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkblacklistca/libraries/checkblacklistca.py ++++ b/repos/system_upgrade/el8toel9/actors/checkblacklistca/libraries/checkblacklistca.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import BlackListCA, BlackListError + +@@ -50,9 +51,14 @@ def process(): + reporting.Title('Distrusted CA certificates will be moved from blacklist to blocklist'), + reporting.Summary( + 'The directories which store user and administrator supplied ' +- 'distrusted certificates have change names from blacklist in ' +- 'RHEL8 to blocklist in RHEL9. As a result {} and ' +- '{} will be deleted.'.format(reportString, deleteString)), ++ 'distrusted certificates were renamed from blacklist in ' ++ '{source_distro} 8 to blocklist in {target_distro} 9. ' ++ 'As a result {report_string} and {delete_string} will be deleted.'.format( ++ report_string=reportString, ++ delete_string=deleteString, ++ **DISTRO_REPORT_NAMES, ++ ) ++ ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SECURITY]), + reporting.Groups([reporting.Groups.AUTHENTICATION]) +@@ -63,11 +69,17 @@ def process(): + reporting.Summary( + 'The directories which stores user and administrator supplied ' + 'distrusted certificates has change names from blacklist in ' +- 'RHEL8 to blocklist in RHEL9. But we are unable to access the ' +- 'RHEL8 directory {} because {}. You can clear this error by ' +- 'correcting the condition, or by moving the contents to {} ' +- 'and removing {} completely' +- '. '.format(ble.sourceDir, ble.error, ble.targetDir, ble.sourceDir)), ++ '{source_distro} 8 to blocklist in {target_distro} 9. ' ++ 'But we are unable to access the {source_distro} 8 directory ' ++ '{source_dir} because {error}. You can clear this error by ' ++ 'correcting the condition, or by moving the contents to ' ++ '{target_dir} and removing {source_dir} completely'.format( ++ source_dir=ble.sourceDir, ++ error=ble.error, ++ target_dir=ble.targetDir, ++ **DISTRO_REPORT_NAMES, ++ ) ++ ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SECURITY]), + reporting.Groups([reporting.Groups.INHIBITOR]), +diff --git a/repos/system_upgrade/el8toel9/actors/checkblacklistca/tests/component_test_checkblacklistca.py b/repos/system_upgrade/el8toel9/actors/checkblacklistca/tests/component_test_checkblacklistca.py +index 2fc27501..af7e6305 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkblacklistca/tests/component_test_checkblacklistca.py ++++ b/repos/system_upgrade/el8toel9/actors/checkblacklistca/tests/component_test_checkblacklistca.py +@@ -1,7 +1,16 @@ ++import pytest ++ ++from leapp.libraries.common import distro + from leapp.models import BlackListCA, BlackListError, Report + from leapp.utils.report import is_inhibitor + + ++@pytest.fixture(autouse=True) ++def common_mocks(monkeypatch): ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') ++ ++ + def test_actor_execution_empty(current_actor_context): + current_actor_context.feed() + current_actor_context.run() +-- +2.53.0 + diff --git a/0012-blsgrubcfgonppc64-Respect-distro-name-in-reports.patch b/0012-blsgrubcfgonppc64-Respect-distro-name-in-reports.patch new file mode 100644 index 0000000..8ddba38 --- /dev/null +++ b/0012-blsgrubcfgonppc64-Respect-distro-name-in-reports.patch @@ -0,0 +1,49 @@ +From a2a3dfb9b14f9582b4c895bda28a3ecb604ea737 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 18:34:34 +0100 +Subject: [PATCH 12/44] blsgrubcfgonppc64: Respect distro name in reports + +Jira: RHEL-130950 +--- + .../libraries/blsgrubcfgonppc64.py | 11 +++++++---- + 1 file changed, 7 insertions(+), 4 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/checkblsgrubcfgonppc64/libraries/blsgrubcfgonppc64.py b/repos/system_upgrade/el8toel9/actors/checkblsgrubcfgonppc64/libraries/blsgrubcfgonppc64.py +index d723df65..58d15e25 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkblsgrubcfgonppc64/libraries/blsgrubcfgonppc64.py ++++ b/repos/system_upgrade/el8toel9/actors/checkblsgrubcfgonppc64/libraries/blsgrubcfgonppc64.py +@@ -1,6 +1,7 @@ + from leapp import reporting + from leapp.libraries.common import grub + from leapp.libraries.common.config import architecture ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import DefaultGrubInfo, FirmwareFacts, GrubCfgBios + +@@ -31,8 +32,9 @@ def process(): + 'Leapp cannot continue with upgrade on "ppc64le" bare metal systems' + ), + reporting.Summary( +- 'In-place upgrade to RHEL 9 is not supported on POWER8 and POWER9 bare metal systems. ' +- 'For more information, refer to the following article: {}'.format(URL) ++ f'In-place upgrade to {DISTRO_REPORT_NAMES.target} 9 is not' ++ ' supported on POWER8 and POWER9 bare metal systems. For more' ++ ' information, refer to the attached article.' + ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups(['inhibitor']), +@@ -54,8 +56,9 @@ def process(): + 'On "ppc64le" systems with BLS enabled, the GRUB configuration is not ' + 'properly converted after the upgrade and Leapp has to run "grub2-mkconfig" ' + '-o /boot/grub2/grub.cfg command in order to fix an issue with booting into ' +- 'the RHEL 8 kernel instead of RHEL 9.' +- ++ 'the {source_distro} 8 kernel instead of {target_distro} 9.'.format_map( ++ DISTRO_REPORT_NAMES ++ ) + ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.BOOT]), +-- +2.53.0 + diff --git a/0013-checkselinux-Respect-distro-name-in-report.patch b/0013-checkselinux-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..b0bc46c --- /dev/null +++ b/0013-checkselinux-Respect-distro-name-in-report.patch @@ -0,0 +1,38 @@ +From b43ed18a6e4cea273def17c83c0c8d1742ba5145 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 16:16:17 +0100 +Subject: [PATCH 13/44] checkselinux: Respect distro name in report + +Jira: RHEL-130950 +--- + .../common/actors/checkselinux/libraries/checkselinux.py | 7 ++++--- + 1 file changed, 4 insertions(+), 3 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkselinux/libraries/checkselinux.py b/repos/system_upgrade/common/actors/checkselinux/libraries/checkselinux.py +index 2ef914ac..dbd79adf 100644 +--- a/repos/system_upgrade/common/actors/checkselinux/libraries/checkselinux.py ++++ b/repos/system_upgrade/common/actors/checkselinux/libraries/checkselinux.py +@@ -1,5 +1,6 @@ + from leapp import reporting + from leapp.libraries.common.config.version import get_target_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import KernelCmdlineArg, SELinuxFacts, SelinuxPermissiveDecision, SelinuxRelabelDecision + +@@ -20,10 +21,10 @@ def process(): + reporting.create_report([ + reporting.Title('LEAPP detected SELinux disabled in "/etc/selinux/config"'), + reporting.Summary( +- 'On RHEL 9, disabling SELinux in "/etc/selinux/config" is no longer possible. ' +- 'This way, the system starts with SELinux enabled but with no policy loaded. LEAPP ' ++ 'On {target_distro} 9, disabling SELinux in "/etc/selinux/config" is no longer possible. ' ++ 'This way, the system starts with SELinux enabled but with no policy loaded. Leapp ' + 'will automatically disable SELinux using "SELINUX=0" kernel command line parameter. ' +- 'However, Red Hat strongly recommends to have SELinux enabled' ++ 'However, it is strongly recommended to have SELinux enabled'.format_map(DISTRO_REPORT_NAMES) + ), + reporting.Severity(reporting.Severity.INFO), + reporting.Groups([reporting.Groups.SELINUX]), +-- +2.53.0 + diff --git a/0014-checkosrelease-Respect-distro-name-in-report.patch b/0014-checkosrelease-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..dbced68 --- /dev/null +++ b/0014-checkosrelease-Respect-distro-name-in-report.patch @@ -0,0 +1,92 @@ +From 60e54a82da37bb0d2f1bee1a35d1d7fa01cf3df7 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 16:44:04 +0100 +Subject: [PATCH 14/44] checkosrelease: Respect distro name in report + +Jira: RHEL-130950 +--- + .../common/actors/checkosrelease/actor.py | 2 +- + .../actors/checkosrelease/libraries/checkosrelease.py | 10 +++++++--- + .../actors/checkosrelease/tests/test_checkosrelease.py | 4 +++- + 3 files changed, 11 insertions(+), 5 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkosrelease/actor.py b/repos/system_upgrade/common/actors/checkosrelease/actor.py +index 7747eb9b..8c60d968 100644 +--- a/repos/system_upgrade/common/actors/checkosrelease/actor.py ++++ b/repos/system_upgrade/common/actors/checkosrelease/actor.py +@@ -6,7 +6,7 @@ from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + + class CheckOSRelease(Actor): + """ +- Check if the current RHEL minor version is supported. If not, inhibit the upgrade process. ++ Check if the current distro version is supported. If not, inhibit the upgrade process. + + This check can be skipped by using the LEAPP_DEVEL_SKIP_CHECK_OS_RELEASE environment variable. + """ +diff --git a/repos/system_upgrade/common/actors/checkosrelease/libraries/checkosrelease.py b/repos/system_upgrade/common/actors/checkosrelease/libraries/checkosrelease.py +index 1ee6e6ab..1ab89a8d 100644 +--- a/repos/system_upgrade/common/actors/checkosrelease/libraries/checkosrelease.py ++++ b/repos/system_upgrade/common/actors/checkosrelease/libraries/checkosrelease.py +@@ -2,6 +2,7 @@ import os + + from leapp import reporting + from leapp.libraries.common.config import version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + + COMMON_REPORT_TAGS = [reporting.Groups.SANITY] + FMT_LIST_SEPARATOR = '\n - ' +@@ -14,7 +15,9 @@ def skip_check(): + if os.getenv('LEAPP_DEVEL_SKIP_CHECK_OS_RELEASE'): + reporting.create_report([ + reporting.Title('Skipped OS release check'), +- reporting.Summary('Source RHEL release check skipped via LEAPP_DEVEL_SKIP_CHECK_OS_RELEASE env var.'), ++ reporting.Summary( ++ 'Source system release check skipped via LEAPP_DEVEL_SKIP_CHECK_OS_RELEASE env variable.' ++ ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups(COMMON_REPORT_TAGS) + ] + related) +@@ -24,7 +27,7 @@ def skip_check(): + + + def check_os_version(): +- """ Check the RHEL minor version and inhibit the upgrade if it does not match the supported ones """ ++ """ Check the distro version and inhibit the upgrade if it does not match the supported ones """ + if not version.is_supported_version(): + supported_releases = [] + for rel in version.SUPPORTED_VERSIONS: +@@ -33,7 +36,8 @@ def check_os_version(): + current_release = ' '.join(version.current_version()).upper() + reporting.create_report([ + reporting.Title( +- 'The installed OS version is not supported for the in-place upgrade to the target RHEL version' ++ 'The installed OS version is not supported for the in-place upgrade' ++ ' to the target {target_distro} version'.format_map(DISTRO_REPORT_NAMES) + ), + reporting.Summary( + 'The supported OS releases for the upgrade process:' +diff --git a/repos/system_upgrade/common/actors/checkosrelease/tests/test_checkosrelease.py b/repos/system_upgrade/common/actors/checkosrelease/tests/test_checkosrelease.py +index 1ca8a1d7..c1c43065 100644 +--- a/repos/system_upgrade/common/actors/checkosrelease/tests/test_checkosrelease.py ++++ b/repos/system_upgrade/common/actors/checkosrelease/tests/test_checkosrelease.py +@@ -3,7 +3,8 @@ import os + from leapp import reporting + from leapp.libraries.actor import checkosrelease + from leapp.libraries.common.config import version +-from leapp.libraries.common.testutils import create_report_mocked, produce_mocked ++from leapp.libraries.common.testutils import create_report_mocked, CurrentActorMocked, produce_mocked ++from leapp.libraries.stdlib import api + from leapp.utils.report import is_inhibitor + + +@@ -26,6 +27,7 @@ def test_no_skip_check(monkeypatch): + + + def test_not_supported_release(monkeypatch): ++ monkeypatch.setattr(api, "current_actor", CurrentActorMocked()) + monkeypatch.setattr(version, "is_supported_version", lambda: False) + monkeypatch.setattr(version, "get_source_major_version", lambda: '8') + monkeypatch.setattr(version, "current_version", lambda: ('bad', '8')) +-- +2.53.0 + diff --git a/0015-rocecheck-Remove-outadated-check-for-source-version.patch b/0015-rocecheck-Remove-outadated-check-for-source-version.patch new file mode 100644 index 0000000..38a9ee0 --- /dev/null +++ b/0015-rocecheck-Remove-outadated-check-for-source-version.patch @@ -0,0 +1,113 @@ +From ce379f96f128b60d93e02f95351e2f718940d2f2 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 23 Feb 2026 12:45:59 +0100 +Subject: [PATCH 15/44] rocecheck: Remove outadated check for source version + +Jira: RHEL-130950 +--- + .../actors/rocecheck/libraries/rocecheck.py | 35 ++----------------- + .../rocecheck/tests/unit_test_rocecheck.py | 22 ------------ + 2 files changed, 3 insertions(+), 54 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py b/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py +index 7549feb8..0ed2046a 100644 +--- a/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py ++++ b/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py +@@ -1,6 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError +-from leapp.libraries.common.config import architecture, version ++from leapp.libraries.common.config import architecture + from leapp.libraries.stdlib import api + from leapp.models import KernelCmdline, RoceDetected + +@@ -37,36 +37,8 @@ def _fmt_list(items): + return ''.join([FMT_LIST_SEPARATOR.format(i) for i in items]) + + +-def _report_old_version(roce): ++def _report_wrong_setup(roce): + roce_nics = roce.roce_nics_connected + roce.roce_nics_connecting +- reporting.create_report([ +- reporting.Title('A newer version of RHEL 8 is required for the upgrade with RoCE.'), +- reporting.Summary( +- 'The RHEL 9 system uses different network schemes for NIC names' +- ' than RHEL 8.' +- ' RHEL {version} does not provide functionality to be able' +- ' to set the system configuration in a way the network interface' +- ' names used by RoCE are persistent on both (RHEL 8 and RHEL 9)' +- ' systems.' +- ' The in-place upgrade from the current version of RHEL to RHEL 9' +- ' will break the RoCE network configuration.' +- '\n\nRoCE detected on following NICs:{nics}' +- .format( +- version=version.get_source_version(), +- nics=_fmt_list(roce_nics) +- ) +- ), +- reporting.Remediation(hint=( +- 'Update the system to RHEL 8.8 or newer using DNF and then reboot' +- ' the system prior the in-place upgrade to RHEL 9.' +- )), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([ +- reporting.Groups.INHIBITOR, +- reporting.Groups.ACCESSIBILITY, +- reporting.Groups.SANITY, +- ]), +- ]) + + + def _report_wrong_setup(roce): +@@ -128,7 +100,6 @@ def process(): + # No used RoCE detected - nothing to do + api.current_logger().debug('Skipping RoCE checks: No RoCE card detected.') + return +- if version.matches_source_version('<= 8.6'): +- _report_old_version(roce) ++ + if not is_kernel_arg_set(): + _report_wrong_setup(roce) +diff --git a/repos/system_upgrade/el8toel9/actors/rocecheck/tests/unit_test_rocecheck.py b/repos/system_upgrade/el8toel9/actors/rocecheck/tests/unit_test_rocecheck.py +index b5511d17..70e4a7b3 100644 +--- a/repos/system_upgrade/el8toel9/actors/rocecheck/tests/unit_test_rocecheck.py ++++ b/repos/system_upgrade/el8toel9/actors/rocecheck/tests/unit_test_rocecheck.py +@@ -52,7 +52,6 @@ def test_roce_noibmz(monkeypatch, arch): + + monkeypatch.setattr(api, 'current_actor', CurrentActorMocked(arch=arch)) + monkeypatch.setattr(reporting, "create_report", create_report_mocked()) +- monkeypatch.setattr(rocecheck, '_report_old_version', mocked_do_not_call_me) + monkeypatch.setattr(rocecheck, '_report_wrong_setup', mocked_do_not_call_me) + monkeypatch.setattr(rocecheck, 'is_kernel_arg_set', mocked_do_not_call_me) + monkeypatch.setattr(rocecheck.api, 'consume', mocked_do_not_call_me) +@@ -76,27 +75,6 @@ def test_roce_ok(monkeypatch, msgs, version): + assert not reporting.create_report.called + + +-@pytest.mark.parametrize('msgs', ( +- [_kernel_cmdline(['net.naming-scheme=rhel-8.7']), _roce(['eno'], [])], +- [_kernel_cmdline(['net.naming-scheme=rhel-8.7']), _roce([], ['eno'])], +- [_kernel_cmdline(['net.naming-scheme=rhel-8.6']), _roce(['eno'], [])], +- [_kernel_cmdline(['net.naming-scheme=rhel-8.6']), _roce(['eno', 'eno1'], ['enp'])], +- [_kernel_cmdline(['foo=bar']), _roce(['eno'], [])], +- [_kernel_cmdline(), _roce(['eno'], [])], +-)) +-@pytest.mark.parametrize('version', ['8.0', '8.3', '8.6']) +-def test_roce_old_rhel(monkeypatch, msgs, version): +- curr_actor_mocked = CurrentActorMocked(arch=architecture.ARCH_S390X, src_ver=version, msgs=msgs) +- monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) +- monkeypatch.setattr(reporting, "create_report", create_report_mocked()) +- rocecheck.process() +- assert reporting.create_report.called +- assert any( +- 'version of RHEL' in report['title'] +- for report in reporting.create_report.reports +- ) +- +- + # NOTE: what about the situation when net.naming-scheme is configured multiple times??? + @pytest.mark.parametrize('msgs', ( + [_kernel_cmdline(['net.naming-scheme=rhel-8.6']), _roce(['eno'], [])], +-- +2.53.0 + diff --git a/0016-rocecheck-Respect-distro-name-in-report.patch b/0016-rocecheck-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..4efe4f2 --- /dev/null +++ b/0016-rocecheck-Respect-distro-name-in-report.patch @@ -0,0 +1,114 @@ +From 18fa991962cb1198173f0ad08a34de27467c32fe Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 23 Feb 2026 13:59:35 +0100 +Subject: [PATCH 16/44] rocecheck: Respect distro name in report + +Jira: RHEL-130950 +--- + .../actors/rocecheck/libraries/rocecheck.py | 81 ++++++++++--------- + 1 file changed, 44 insertions(+), 37 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py b/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py +index 0ed2046a..5014a8db 100644 +--- a/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py ++++ b/repos/system_upgrade/el8toel9/actors/rocecheck/libraries/rocecheck.py +@@ -1,6 +1,7 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError +-from leapp.libraries.common.config import architecture ++from leapp.libraries.common.config import architecture, get_target_distro_id ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import KernelCmdline, RoceDetected + +@@ -40,45 +41,51 @@ def _fmt_list(items): + def _report_wrong_setup(roce): + roce_nics = roce.roce_nics_connected + roce.roce_nics_connecting + ++ summary = ( ++ 'The {target_distro} 9 system uses different network schemes for NIC names' ++ ' than {source_distro} 8.' ++ ' The below listed RoCE NICs need to be reconfigured to the new' ++ ' interface naming scheme in order to prevent loss of network' ++ ' access to your system via these interfaces after the upgrade.' ++ ' For more information, see: {url}' ++ '\n\nRoCE detected on the following NICs:{nics}' ++ ).format( ++ nics=_fmt_list(roce_nics), ++ url=DOC_URL, ++ **DISTRO_REPORT_NAMES, ++ ) ++ remmediation_hint = ( ++ 'Prerequisite for upgrading to {target_distro} {target_version}:' ++ 'In {source_distro} 8, all RoCE cards must be configured with the interface' ++ ' names they should have in {target_distro} {target_version}.\n' ++ 'For more information, see chapter 1.4 of the RHEL 8 Product' ++ ' Documentation (see the attached link) and follow these steps:\n' ++ '1.) determine the current interface device names of the RoCE' ++ ' cards that are in "connected to" or in "connecting" state\n' ++ '2.) determine if UID uniqueness is set for these cards\n' ++ '3.) compute new interface device names from the UID or the' ++ ' function ID, respectively\n' ++ '4.) change the network interface device names in ifcfg' ++ ' files\n' ++ '5.) set the kernel parameter net.naming-scheme=rhel-8.7 in the' ++ ' effective .conf file in /boot/loader/entries\n' ++ '6.) adjust other settings that rely on the interface device names' ++ ' (e.g. firewall) by changing the interface device names' ++ ' accordingly\n' ++ '7.) run `zipl -V` and reboot the system\n' ++ '8.) check your network connectivity\n' ++ '\n' ++ 'Caution: Creating an incorrect configuration might cause the loss' ++ ' of your network connection after reboot!' ++ ).format( ++ target_version="9" if get_target_distro_id() == "centos" else "9.x", ++ **DISTRO_REPORT_NAMES, ++ ) + +-def _report_wrong_setup(roce): +- roce_nics = roce.roce_nics_connected + roce.roce_nics_connecting + reporting.create_report([ + reporting.Title('Invalid RoCE configuration for the in-place upgrade'), +- reporting.Summary( +- 'The RHEL 9 system uses different network schemes for NIC names' +- ' than RHEL 8.' +- ' The below listed RoCE NICs need to be reconfigured to the new' +- ' interface naming scheme in order to prevent loss of network' +- ' access to your system via these interfaces after the upgrade.' +- ' For more information, see: {url}' +- '\n\nRoCE detected on the following NICs:{nics}' +- .format(nics=_fmt_list(roce_nics), url=DOC_URL) +- ), +- reporting.Remediation(hint=( +- 'Prerequisite for upgrading to RHEL9.x:' +- 'In RHEL 8, all RoCE cards must be configured with the interface' +- ' names they should have in RHEL9.x.\n' +- 'For more information, see chapter 1.4 of the RHEL8 Product' +- ' Documentation (see the attached link) and follow these steps:\n' +- '1.) determine the current interface device names of the RoCE' +- ' cards that are in "connected to" or in "connecting" state\n' +- '2.) determine if UID uniqueness is set for these cards\n' +- '3.) compute new interface device names from the UID or the' +- ' function ID, respectively\n' +- '4.) change the network interface device names in ifcfg' +- ' files\n' +- '5.) set the kernel parameter net.naming-scheme=rhel-8.7 in the' +- ' effective .conf file in /boot/loader/entries\n' +- '6.) adjust other settings that rely on the interface device names' +- ' (e.g. firewall) by changing the interface device names' +- ' accordingly\n' +- '7.) run `zipl -V` and reboot the system\n' +- '8.) check your network connectivity\n' +- '\n' +- 'Caution: Creating an incorrect configuration might cause the loss' +- ' of your network connection after reboot!' +- )), ++ reporting.Summary(summary), ++ reporting.Remediation(hint=remmediation_hint), + reporting.ExternalLink( + title='Predictable network interface device names on the System z platform', + url=DOC_URL), +-- +2.53.0 + diff --git a/0017-opensshpermitrootlogincheck-Remove-7to8-related-code.patch b/0017-opensshpermitrootlogincheck-Remove-7to8-related-code.patch new file mode 100644 index 0000000..58e12b4 --- /dev/null +++ b/0017-opensshpermitrootlogincheck-Remove-7to8-related-code.patch @@ -0,0 +1,101 @@ +From 71aa340ff3c2b5b9cd25e0aa731ace1b87e46d7f Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 23 Feb 2026 14:15:18 +0100 +Subject: [PATCH 17/44] opensshpermitrootlogincheck: Remove 7to8 related code + +Jira: RHEL-130950 +--- + .../opensshpermitrootlogincheck/actor.py | 64 +------------------ + 1 file changed, 2 insertions(+), 62 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py b/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py +index 98d329ab..3aedfd5e 100644 +--- a/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py ++++ b/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py +@@ -1,7 +1,7 @@ + from leapp import reporting + from leapp.actors import Actor + from leapp.exceptions import StopActorExecutionError +-from leapp.libraries.actor.opensshpermitrootlogincheck import global_value, semantics_changes ++from leapp.libraries.actor.opensshpermitrootlogincheck import global_value + from leapp.libraries.common.config.version import get_source_major_version + from leapp.libraries.stdlib import api + from leapp.models import OpenSshConfig, Report +@@ -46,73 +46,13 @@ class OpenSshPermitRootLoginCheck(Actor): + 'Could not check openssh configuration', details={'details': 'No OpenSshConfig facts found.'} + ) + +- if get_source_major_version() == '7': +- self.process7to8(config) +- elif get_source_major_version() == '8': ++ if get_source_major_version() == '8': + self.process8to9(config) + elif int(get_source_major_version()) >= 9: + pass + else: + api.current_logger().warning('Unknown source major version: {}'.format(get_source_major_version())) + +- @staticmethod +- def process7to8(config): +- # when the config was not modified, we can pass this check and let the +- # rpm handle the configuration file update +- if not config.modified: +- return +- +- # When the configuration does not contain *any* PermitRootLogin directive and +- # the configuration file was locally modified, it will not get updated by +- # RPM and the user might be locked away from the server with new default +- if not config.permit_root_login: +- create_report([ +- reporting.Title('Possible problems with remote login using root account'), +- reporting.Summary( +- 'OpenSSH configuration file does not explicitly state ' +- 'the option PermitRootLogin in sshd_config file, ' +- 'which will default in RHEL8 to "prohibit-password".' +- ), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups(COMMON_REPORT_TAGS), +- reporting.Remediation( +- hint='If you depend on remote root logins using passwords, consider ' +- 'setting up a different user for remote administration or adding ' +- '"PermitRootLogin yes" to sshd_config. ' +- 'If this change is ok for you, add explicit ' +- '"PermitRootLogin prohibit-password" to your sshd_config ' +- 'to ignore this inhibitor' +- ), +- reporting.Groups([reporting.Groups.INHIBITOR]) +- ] + COMMON_RESOURCES) +- return +- +- # Check if there is at least one PermitRootLogin other than "no" +- # in match blocks (other than Match All). +- # This usually means some more complicated setup depending on the +- # default value being globally "yes" and being overwritten by this +- # match block +- if semantics_changes(config): +- create_report([ +- reporting.Title('OpenSSH configured to allow root login'), +- reporting.Summary( +- 'OpenSSH is configured to deny root logins in match ' +- 'blocks, but not explicitly enabled in global or ' +- '"Match all" context. This update changes the ' +- 'default to disable root logins using passwords ' +- 'so your server might get inaccessible.' +- ), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups(COMMON_REPORT_TAGS), +- reporting.Remediation( +- hint='Consider using different user for administrative ' +- 'logins or make sure your configuration file ' +- 'contains the line "PermitRootLogin yes" ' +- 'in global context if desired.' +- ), +- reporting.Groups([reporting.Groups.INHIBITOR]) +- ] + COMMON_RESOURCES) +- + @staticmethod + def process8to9(config): + # RHEL8 default sshd configuration file is not modified: It will get replaced by rpm and +-- +2.53.0 + diff --git a/0018-opensshpermitrootlogincheck-Respect-target-distro-na.patch b/0018-opensshpermitrootlogincheck-Respect-target-distro-na.patch new file mode 100644 index 0000000..d43afca --- /dev/null +++ b/0018-opensshpermitrootlogincheck-Respect-target-distro-na.patch @@ -0,0 +1,60 @@ +From d5edd261a729f0a83aa9642bf3655acf63f8808e Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 23 Feb 2026 14:15:38 +0100 +Subject: [PATCH 18/44] opensshpermitrootlogincheck: Respect target distro name + in report + +Jira: RHEL-130950 +--- + .../actors/opensshpermitrootlogincheck/actor.py | 17 ++++++++++------- + 1 file changed, 10 insertions(+), 7 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py b/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py +index 3aedfd5e..93ee5021 100644 +--- a/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py ++++ b/repos/system_upgrade/common/actors/opensshpermitrootlogincheck/actor.py +@@ -3,6 +3,7 @@ from leapp.actors import Actor + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.actor.opensshpermitrootlogincheck import global_value + from leapp.libraries.common.config.version import get_source_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import OpenSshConfig, Report + from leapp.reporting import create_report +@@ -62,12 +63,12 @@ class OpenSshPermitRootLoginCheck(Actor): + create_report([ + reporting.Title('Possible problems with remote login using root account'), + reporting.Summary( +- 'OpenSSH configuration file will get updated to RHEL9 ' ++ 'OpenSSH configuration file will get updated to {target_distro} 9 ' + 'version, no longer allowing root login with password. ' + 'It is a good practice to use non-root administrative ' + 'user and non-password authentications, but if you rely ' + 'on the remote root login, this change can lock you out ' +- 'of this system.' ++ 'of this system.'.format_map(DISTRO_REPORT_NAMES) + ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups(COMMON_REPORT_TAGS), +@@ -93,11 +94,13 @@ class OpenSshPermitRootLoginCheck(Actor): + create_report([ + reporting.Title('Remote root logins globally allowed using password'), + reporting.Summary( +- 'RHEL9 no longer allows remote root logins, but the ' +- 'server configuration explicitly overrides this default. ' +- 'The configuration file will not be updated and root is ' +- 'still going to be allowed to login with password. ' +- 'This is not recommended and considered as a security risk.' ++ '{target_distro} 9 no longer allows remote root logins, but ' ++ 'the server configuration explicitly overrides this default. ' ++ 'The configuration file will not be updated and root is still' ++ 'going to be allowed to login with password. This is not ' ++ 'recommended and considered as a security risk. '.format_map( ++ DISTRO_REPORT_NAMES ++ ) + ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups(COMMON_REPORT_TAGS), +-- +2.53.0 + diff --git a/0019-checkifcfg_ifcfg-Respect-distro-name-in-report.patch b/0019-checkifcfg_ifcfg-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..46f75ab --- /dev/null +++ b/0019-checkifcfg_ifcfg-Respect-distro-name-in-report.patch @@ -0,0 +1,120 @@ +From 61dc43540b15c71a8a2c2d5705c5952de059b6d8 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 18:05:37 +0100 +Subject: [PATCH 19/44] checkifcfg_ifcfg: Respect distro name in report + +Jira: RHEL-130950 +--- + .../checkifcfg/libraries/checkifcfg_ifcfg.py | 37 +++++++++++++------ + .../checkifcfg/tests/unit_test_ifcfg.py | 9 ++++- + 2 files changed, 32 insertions(+), 14 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/checkifcfg/libraries/checkifcfg_ifcfg.py b/repos/system_upgrade/el8toel9/actors/checkifcfg/libraries/checkifcfg_ifcfg.py +index ed666350..79ede81e 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkifcfg/libraries/checkifcfg_ifcfg.py ++++ b/repos/system_upgrade/el8toel9/actors/checkifcfg/libraries/checkifcfg_ifcfg.py +@@ -1,6 +1,7 @@ + import os + + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.common.rpms import has_package + from leapp.libraries.stdlib import api + from leapp.models import IfCfg, InstalledRPM, RpmTransactionTasks +@@ -8,6 +9,12 @@ from leapp.models import IfCfg, InstalledRPM, RpmTransactionTasks + FMT_LIST_SEPARATOR = '\n - ' + + ++def _format_files_list(files): ++ return "".join( ++ ["{}{}".format(FMT_LIST_SEPARATOR, f) for f in files] ++ ) ++ ++ + def process(): + TRUE_VALUES = ['yes', 'true', '1'] + TYPE_MAP = { +@@ -74,12 +81,15 @@ def process(): + + if bad_type_files: + title = 'Network configuration for unsupported device types detected' +- summary = ('RHEL 9 does not support the legacy network-scripts' +- ' package that was deprecated in RHEL 8 in favor of' +- ' NetworkManager. Files for device types that are not' +- ' supported by NetworkManager are present in the system.' +- ' Files with the problematic configuration:{}').format( +- ''.join(['{}{}'.format(FMT_LIST_SEPARATOR, bfile) for bfile in bad_type_files]) ++ summary = ( ++ "{target_distro} 9 does not support the legacy network-scripts" ++ " package that was deprecated in {source_distro} 8 in favor of" ++ " NetworkManager. Files for device types that are not" ++ " supported by NetworkManager are present in the system." ++ " Files with the problematic configuration:{bad_files}".format( ++ bad_files=_format_files_list(bad_type_files), ++ **DISTRO_REPORT_NAMES, ++ ) + ) + remediation = ('Consult the nm-settings-ifcfg-rh(5) manual for' + ' valid types of ifcfg files. Remove configuration' +@@ -104,12 +114,15 @@ def process(): + + if not_controlled_files: + title = 'Network configuration with disabled NetworkManager support detected' +- summary = ('RHEL 9 does not support the legacy network-scripts' +- ' package that was deprecated in RHEL 8 in favor of' +- ' NetworkManager. Configuration present in the system' +- ' prohibit NetworkManager from loading it.' +- ' Files with the problematic configuration:{}').format( +- ''.join(['{}{}'.format(FMT_LIST_SEPARATOR, bfile) for bfile in not_controlled_files]) ++ summary = ( ++ '{target_distro} 9 does not support the legacy network-scripts' ++ ' package that was deprecated in {source_distro} 8 in favor of' ++ ' NetworkManager. Configuration present in the system' ++ ' prohibit NetworkManager from loading it.' ++ ' Files with the problematic configuration:{bad_files}' ++ ).format( ++ bad_files=_format_files_list(not_controlled_files), ++ **DISTRO_REPORT_NAMES, + ) + remediation = ('Ensure the ifcfg files comply with format described in' + ' nm-settings-ifcfg-rh(5) manual and remove the' +diff --git a/repos/system_upgrade/el8toel9/actors/checkifcfg/tests/unit_test_ifcfg.py b/repos/system_upgrade/el8toel9/actors/checkifcfg/tests/unit_test_ifcfg.py +index ddabedf2..02ffc65c 100644 +--- a/repos/system_upgrade/el8toel9/actors/checkifcfg/tests/unit_test_ifcfg.py ++++ b/repos/system_upgrade/el8toel9/actors/checkifcfg/tests/unit_test_ifcfg.py +@@ -1,3 +1,4 @@ ++from leapp.libraries.common import distro + from leapp.models import IfCfg, IfCfgProperty, InstalledRPM, RPM, RpmTransactionTasks + from leapp.reporting import Report + from leapp.utils.report import is_inhibitor +@@ -85,10 +86,12 @@ def test_ifcfg_good_type(current_actor_context): + assert rpm_transaction.to_install == ["NetworkManager"] + + +-def test_ifcfg_not_controlled(current_actor_context): ++def test_ifcfg_not_controlled(monkeypatch, current_actor_context): + """ + Report if there's a NM_CONTROLLED=no file. + """ ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') + + current_actor_context.feed(IfCfg( + filename="/NM/ifcfg-eth0", +@@ -105,10 +108,12 @@ def test_ifcfg_not_controlled(current_actor_context): + assert "disabled NetworkManager" in report_fields['title'] + + +-def test_ifcfg_unknown_type(current_actor_context): ++def test_ifcfg_unknown_type(monkeypatch, current_actor_context): + """ + Report if there's configuration for a type we don't recognize. + """ ++ monkeypatch.setattr(distro, 'get_source_distro_id', lambda: 'rhel') ++ monkeypatch.setattr(distro, 'get_target_distro_id', lambda: 'rhel') + + current_actor_context.feed(IfCfg( + filename="/NM/ifcfg-pigeon0", +-- +2.53.0 + diff --git a/0020-opensslproviders-Use-distro-name-in-the-leapp-commen.patch b/0020-opensslproviders-Use-distro-name-in-the-leapp-commen.patch new file mode 100644 index 0000000..b14f6eb --- /dev/null +++ b/0020-opensslproviders-Use-distro-name-in-the-leapp-commen.patch @@ -0,0 +1,155 @@ +From 747e4467aafe7c97b2a02b67527af70083a89e91 Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 18:11:02 +0100 +Subject: [PATCH 20/44] opensslproviders: Use distro name in the leapp comment + +Jira: RHEL-130950 +--- + .../libraries/add_provider.py | 13 ++-- + .../tests/test_add_provider.py | 66 ++++++++++++------- + 2 files changed, 53 insertions(+), 26 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/opensslproviders/libraries/add_provider.py b/repos/system_upgrade/el8toel9/actors/opensslproviders/libraries/add_provider.py +index 91462f18..3bf4cbf8 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensslproviders/libraries/add_provider.py ++++ b/repos/system_upgrade/el8toel9/actors/opensslproviders/libraries/add_provider.py +@@ -2,13 +2,13 @@ import re + + from leapp import reporting + from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + + # The openssl configuration file + # TODO copied from opensslconfigscanner/libraries/readconf.py + CONFIG = '/etc/pki/tls/openssl.cnf' + +-LEAPP_COMMENT = '# Modified by leapp during upgrade to RHEL 9\n' + APPEND_STRING = ( + '[provider_sect]\n' + 'default = default_sect\n' +@@ -22,6 +22,11 @@ APPEND_STRING = ( + ) + + ++def _get_leapp_comment(): ++ # cannot access DISTRO_REPORT_NAMES at top level ++ return f"# Modified by leapp during upgrade to {DISTRO_REPORT_NAMES.target} 9\n" ++ ++ + def _add_lines(lines, add): + """ + Add lines to the list of lines. Breaking possible newlines onto separate items +@@ -76,12 +81,12 @@ def _modify_file(f, fail_on_error=True): + lines = f.readlines() + lines = _replace(lines, r"openssl_conf\s*=\s*default_modules", + "openssl_conf = openssl_init", +- LEAPP_COMMENT, True, fail_on_error) ++ _get_leapp_comment(), True, fail_on_error) + lines = _replace(lines, r"\[\s*default_modules\s*\]", + "[openssl_init]\n" + "providers = provider_sect", +- LEAPP_COMMENT, True, fail_on_error) +- lines = _append(lines, APPEND_STRING, LEAPP_COMMENT) ++ _get_leapp_comment(), True, fail_on_error) ++ lines = _append(lines, APPEND_STRING, _get_leapp_comment()) + f.seek(0) + f.write(''.join(lines)) + +diff --git a/repos/system_upgrade/el8toel9/actors/opensslproviders/tests/test_add_provider.py b/repos/system_upgrade/el8toel9/actors/opensslproviders/tests/test_add_provider.py +index 78f2e9c6..c6e31c29 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensslproviders/tests/test_add_provider.py ++++ b/repos/system_upgrade/el8toel9/actors/opensslproviders/tests/test_add_provider.py +@@ -3,12 +3,14 @@ import pytest + from leapp.libraries.actor.add_provider import ( + _add_lines, + _append, ++ _get_leapp_comment, + _modify_file, + _replace, + APPEND_STRING, +- LEAPP_COMMENT, + NotFoundException + ) ++from leapp.libraries.common.testutils import CurrentActorMocked ++from leapp.libraries.stdlib import api + + testdata = ( + ([], 'one', ['one\n']), +@@ -80,32 +82,52 @@ class MockFile: + + + testdata = ( +- ('', ''), +- ('openssl_conf=default_modules\n', +- '{}# openssl_conf=default_modules\nopenssl_conf = openssl_init\n'.format(LEAPP_COMMENT)), +- ('openssl_conf = default_modules\n', +- '{}# openssl_conf = default_modules\nopenssl_conf = openssl_init\n'.format(LEAPP_COMMENT)), +- ('openssl_conf = default_modules\n', +- '{}# openssl_conf = default_modules\nopenssl_conf = openssl_init\n'.format(LEAPP_COMMENT)), +- (' openssl_conf = default_modules \n', +- '{}# openssl_conf = default_modules \nopenssl_conf = openssl_init\n'.format(LEAPP_COMMENT)), +- ('[default_modules]\n', +- '{}# [default_modules]\n[openssl_init]\nproviders = provider_sect\n'.format(LEAPP_COMMENT)), +- ('[ default_modules ]\n', +- '{}# [ default_modules ]\n[openssl_init]\nproviders = provider_sect\n'.format(LEAPP_COMMENT)), +- (' [ default_modules ] \n', +- '{}# [ default_modules ] \n[openssl_init]\nproviders = provider_sect\n'.format(LEAPP_COMMENT)), +- ('openssl_conf=default_modules\n[default_modules]\n', +- '{c}# openssl_conf=default_modules\nopenssl_conf = openssl_init\n' +- '{c}# [default_modules]\n[openssl_init]\nproviders = provider_sect\n'.format(c=LEAPP_COMMENT)), ++ ("", ""), ++ ( ++ "openssl_conf=default_modules\n", ++ "{c}# openssl_conf=default_modules\nopenssl_conf = openssl_init\n", ++ ), ++ ( ++ "openssl_conf = default_modules\n", ++ "{c}# openssl_conf = default_modules\nopenssl_conf = openssl_init\n", ++ ), ++ ( ++ "openssl_conf = default_modules\n", ++ "{c}# openssl_conf = default_modules\nopenssl_conf = openssl_init\n", ++ ), ++ ( ++ " openssl_conf = default_modules \n", ++ "{c}# openssl_conf = default_modules \nopenssl_conf = openssl_init\n", ++ ), ++ ( ++ "[default_modules]\n", ++ "{c}# [default_modules]\n[openssl_init]\nproviders = provider_sect\n", ++ ), ++ ( ++ "[ default_modules ]\n", ++ "{c}# [ default_modules ]\n[openssl_init]\nproviders = provider_sect\n", ++ ), ++ ( ++ " [ default_modules ] \n", ++ "{c}# [ default_modules ] \n[openssl_init]\nproviders = provider_sect\n", ++ ), ++ ( ++ "openssl_conf=default_modules\n[default_modules]\n", ++ "{c}# openssl_conf=default_modules\nopenssl_conf = openssl_init\n" ++ "{c}# [default_modules]\n[openssl_init]\nproviders = provider_sect\n", ++ ), + ) + + + @pytest.mark.parametrize('file_content,expected', testdata) +-def test_modify_file(file_content, expected): +- f = MockFile(file_content) ++def test_modify_file(monkeypatch, file_content, expected): ++ monkeypatch.setattr(api, 'current_actor', CurrentActorMocked()) ++ ++ f = MockFile(file_content.format(c=_get_leapp_comment())) + + # Test separate replaces and do not fail if pattern is not found + _modify_file(f, False) + +- assert f.content == "{}{}{}\n".format(expected, LEAPP_COMMENT, APPEND_STRING) ++ assert f.content == "{}{}{}\n".format( ++ expected.format(c=_get_leapp_comment()), _get_leapp_comment(), APPEND_STRING ++ ) +-- +2.53.0 + diff --git a/0021-opensslconfigcheck-Dont-make-the-recommendation-as-r.patch b/0021-opensslconfigcheck-Dont-make-the-recommendation-as-r.patch new file mode 100644 index 0000000..d65b471 --- /dev/null +++ b/0021-opensslconfigcheck-Dont-make-the-recommendation-as-r.patch @@ -0,0 +1,75 @@ +From 35ea535848223e32bd01d726a838abd2ae84fa3e Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Mon, 2 Mar 2026 18:30:51 +0100 +Subject: [PATCH 21/44] opensslconfigcheck: Dont make the recommendation as + redhat if not rhel target + +Jira: RHEL-130950 +--- + .../opensslconfigcheck/libraries/opensslconfigcheck.py | 9 +++++++-- + .../tests/component_test_opensslconfigcheck.py | 7 +++++-- + 2 files changed, 12 insertions(+), 4 deletions(-) + +diff --git a/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/libraries/opensslconfigcheck.py b/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/libraries/opensslconfigcheck.py +index 07c1b22f..a686a7f2 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/libraries/opensslconfigcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/libraries/opensslconfigcheck.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.config import get_target_distro_id + from leapp.libraries.stdlib import api + + +@@ -228,14 +229,18 @@ def check_crypto_policies(config): + path=("default_modules", "ssl_conf", "ssl_module", + "system_default", "crypto_policy", ".include"), + value="/etc/crypto-policies/back-ends/opensslcnf.config"): ++ + reporting.create_report([ + reporting.Title('The OpenSSL configuration is missing the crypto policies integration'), ++ + reporting.Summary( + 'The OpenSSL configuration file `/etc/pki/tls/openssl.cnf` does not contain the ' + 'directive to include the system-wide crypto policies. This is not recommended ' +- 'by Red Hat and can lead to decreasing overall system security and inconsistent ' ++ '{} can lead to decreasing overall system security and inconsistent ' + 'behavior between applications. If you need to adjust the crypto policies to your ' +- 'needs, it is recommended to use custom crypto policies.' ++ 'needs, it is recommended to use custom crypto policies.'.format( ++ "by Red Hat and" if get_target_distro_id() == "rhel" else "as it" ++ ) + ), + reporting.Severity(reporting.Severity.MEDIUM), + reporting.Groups([ +diff --git a/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/tests/component_test_opensslconfigcheck.py b/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/tests/component_test_opensslconfigcheck.py +index d3363def..892cb7f1 100644 +--- a/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/tests/component_test_opensslconfigcheck.py ++++ b/repos/system_upgrade/el8toel9/actors/opensslconfigcheck/tests/component_test_opensslconfigcheck.py +@@ -1,3 +1,4 @@ ++from leapp.libraries.actor import opensslconfigcheck + from leapp.models import OpenSslConfig, OpenSslConfigBlock, OpenSslConfigPair, Report + + +@@ -12,7 +13,8 @@ def test_actor_execution_empty(current_actor_context): + assert not current_actor_context.consume(Report) + + +-def test_actor_execution_empty_modified(current_actor_context): ++def test_actor_execution_empty_modified(current_actor_context, monkeypatch): ++ monkeypatch.setattr(opensslconfigcheck, 'get_target_distro_id', lambda: 'rhel') + current_actor_context.feed( + OpenSslConfig( + blocks=[], +@@ -25,7 +27,8 @@ def test_actor_execution_empty_modified(current_actor_context): + assert 'missing the crypto policies integration' in r[0].report['title'] + + +-def test_actor_execution_default_modified(current_actor_context): ++def test_actor_execution_default_modified(current_actor_context, monkeypatch): ++ monkeypatch.setattr(opensslconfigcheck, 'get_target_distro_id', lambda: 'rhel') + current_actor_context.feed( + OpenSslConfig( + openssl_conf='default_modules', +-- +2.53.0 + diff --git a/0022-checkmicroarchitecture-Respect-distro-name-in-report.patch b/0022-checkmicroarchitecture-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..9bda99a --- /dev/null +++ b/0022-checkmicroarchitecture-Respect-distro-name-in-report.patch @@ -0,0 +1,73 @@ +From 367654a5eeaa1a13d857ff04acdc1e7890550fc1 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 17:35:53 +0100 +Subject: [PATCH 22/44] checkmicroarchitecture: Respect distro name in report + +Also add stable report key, the title used for key computation was using +target major ver == 8: +'Current x86-64 microarchitecture is unsupported in RHEL8' + +Jira: RHEL-130950 +--- + .../libraries/checkmicroarchitecture.py | 17 ++++++++++------- + 1 file changed, 10 insertions(+), 7 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkmicroarchitecture/libraries/checkmicroarchitecture.py b/repos/system_upgrade/common/actors/checkmicroarchitecture/libraries/checkmicroarchitecture.py +index a063b534..3011f906 100644 +--- a/repos/system_upgrade/common/actors/checkmicroarchitecture/libraries/checkmicroarchitecture.py ++++ b/repos/system_upgrade/common/actors/checkmicroarchitecture/libraries/checkmicroarchitecture.py +@@ -3,6 +3,7 @@ from collections import namedtuple + from leapp import reporting + from leapp.libraries.common.config.architecture import ARCH_X86_64, matches_architecture + from leapp.libraries.common.config.version import get_target_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import CPUInfo + +@@ -13,11 +14,11 @@ X86_64_V3_FLAGS = ['avx2', 'bmi1', 'bmi2', 'f16c', 'fma', 'abm', 'movbe', 'xsave + MicroarchInfo = namedtuple('MicroarchInfo', ('required_flags', 'extra_report_fields', 'microarch_ver')) + + +-def _inhibit_upgrade(missing_flags, target_rhel, microarch_ver, extra_report_fields=None): +- title = 'Current x86-64 microarchitecture is unsupported in {0}'.format(target_rhel) ++def _inhibit_upgrade(missing_flags, target_distro, microarch_ver, extra_report_fields=None): ++ title = 'Current x86-64 microarchitecture is unsupported in the target OS' + summary = ('{0} has a higher CPU requirement than older versions, it now requires a CPU ' + 'compatible with {1} instruction set or higher.\n\n' +- 'Missings flags detected are: {2}\n').format(target_rhel, microarch_ver, ', '.join(missing_flags)) ++ 'Missings flags detected are: {2}\n').format(target_distro, microarch_ver, ', '.join(missing_flags)) + + report_fields = [ + reporting.Title(title), +@@ -28,7 +29,8 @@ def _inhibit_upgrade(missing_flags, target_rhel, microarch_ver, extra_report_fie + reporting.Remediation(hint=('If a case of using virtualization, virtualization platforms often allow ' + 'configuring a minimum denominator CPU model for compatibility when migrating ' + 'between different CPU models. Ensure that minimum requirements are not below ' +- 'that of {0}\n').format(target_rhel)), ++ 'that of {0}\n').format(target_distro)), ++ reporting.Key('0f48cdbe5aa2584e2ca7f4eb470b9b79da9e515d') + ] + + if extra_report_fields: +@@ -69,14 +71,15 @@ def process(): + + microarch_info = rhel_major_to_microarch_reqs.get(get_target_major_version()) + if not microarch_info: +- api.current_logger().info('No known microarchitecture requirements are known for target RHEL%s.', +- get_target_major_version()) ++ api.current_logger().info( ++ 'No known microarchitecture requirements are known' ++ ' for target {target_distro} {version}.'.format(**DISTRO_REPORT_NAMES, version=get_target_major_version())) + return + + missing_flags = [flag for flag in microarch_info.required_flags if flag not in cpuinfo.flags] + api.current_logger().debug('Required flags missing: %s', missing_flags) + if missing_flags: + _inhibit_upgrade(missing_flags, +- 'RHEL{0}'.format(get_target_major_version()), ++ '{target_distro} {version}'.format(**DISTRO_REPORT_NAMES, version=get_target_major_version()), + microarch_info.microarch_ver, + extra_report_fields=microarch_info.extra_report_fields) +-- +2.53.0 + diff --git a/0023-checkmemory-Respect-distro-name-in-reports.patch b/0023-checkmemory-Respect-distro-name-in-reports.patch new file mode 100644 index 0000000..118f6f8 --- /dev/null +++ b/0023-checkmemory-Respect-distro-name-in-reports.patch @@ -0,0 +1,88 @@ +From 0e250cdc4672263d753209c420c15a33f9ae90eb Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 17:45:16 +0100 +Subject: [PATCH 23/44] checkmemory: Respect distro name in reports + +Also add stable key to the report, the distro key was computed as if for +7->8 upgrade, the title: +'Minimum memory requirements for RHEL 8 are not met' + +as the reports for 8->9 and 9->10 are unified with the above report, the +following keys are no longer used: +Minimum memory requirements for RHEL 9 are not met -> e3066f6fae135718b3158597145554c4f22b9372 +Minimum memory requirements for RHEL 10 are not met -> ccf14c3ac899f3cdc3123dadac399cafe28ce2ef + +Jira: RHEL-130950 +--- + .../checkmemory/libraries/checkmemory.py | 33 ++++++++++--------- + .../checkmemory/tests/test_checkmemory.py | 2 +- + 2 files changed, 18 insertions(+), 17 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkmemory/libraries/checkmemory.py b/repos/system_upgrade/common/actors/checkmemory/libraries/checkmemory.py +index 040b404b..cdf8faa6 100644 +--- a/repos/system_upgrade/common/actors/checkmemory/libraries/checkmemory.py ++++ b/repos/system_upgrade/common/actors/checkmemory/libraries/checkmemory.py +@@ -1,6 +1,6 @@ + from leapp import reporting + from leapp.exceptions import StopActorExecutionError +-from leapp.libraries.common.config import architecture, version ++from leapp.libraries.common.config import architecture + from leapp.libraries.stdlib import api + from leapp.models import MemoryInfo + +@@ -32,23 +32,24 @@ def process(): + minimum_req_error = _check_memory(memoryinfo) + + if minimum_req_error: +- title = 'Minimum memory requirements for RHEL {} are not met'.format(version.get_target_major_version()) ++ title = "Minimum memory requirements for the target OS are not met" + summary = 'Memory detected: {} MiB, required: {} MiB'.format( + int(minimum_req_error['detected'] / 1024), + int(minimum_req_error['minimal_req'] / 1024), + ) + reporting.create_report([ +- reporting.Title(title), +- reporting.Summary(summary), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.SANITY, reporting.Groups.INHIBITOR]), +- reporting.ExternalLink( +- url='https://access.redhat.com/solutions/7014179', +- title='Leapp upgrade fail with error"Minimum memory requirements ' +- 'for RHEL 8 are not met"Upgrade cannot proceed' +- ), +- reporting.ExternalLink( +- url='https://access.redhat.com/articles/rhel-limits', +- title='Red Hat Enterprise Linux Technology Capabilities and Limits' +- ), +- ]) ++ reporting.Title(title), ++ reporting.Summary(summary), ++ reporting.Severity(reporting.Severity.HIGH), ++ reporting.Groups([reporting.Groups.SANITY, reporting.Groups.INHIBITOR]), ++ reporting.ExternalLink( ++ url='https://access.redhat.com/solutions/7014179', ++ title='Leapp upgrade fail with error "Minimum memory requirements ' ++ 'for RHEL 8 are not met"Upgrade cannot proceed' ++ ), ++ reporting.ExternalLink( ++ url='https://access.redhat.com/articles/rhel-limits', ++ title='Red Hat Enterprise Linux Technology Capabilities and Limits' ++ ), ++ reporting.Key('be50646b45beb8304c13daf5380d836a4be8e1cc'), ++ ]) +diff --git a/repos/system_upgrade/common/actors/checkmemory/tests/test_checkmemory.py b/repos/system_upgrade/common/actors/checkmemory/tests/test_checkmemory.py +index 79158dc6..38ddfa33 100644 +--- a/repos/system_upgrade/common/actors/checkmemory/tests/test_checkmemory.py ++++ b/repos/system_upgrade/common/actors/checkmemory/tests/test_checkmemory.py +@@ -21,7 +21,7 @@ def test_check_memory_high(monkeypatch): + + + def test_report(monkeypatch): +- title_msg = 'Minimum memory requirements for RHEL 9 are not met' ++ title_msg = 'Minimum memory requirements for the target OS are not met' + monkeypatch.setattr(api, 'current_actor', CurrentActorMocked()) + monkeypatch.setattr(api, 'consume', lambda x: iter([MemoryInfo(mem_total=129)])) + monkeypatch.setattr(reporting, "create_report", create_report_mocked()) +-- +2.53.0 + diff --git a/0024-targetuserspacecreator-Respect-distro-name-in-report.patch b/0024-targetuserspacecreator-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..8056dd9 --- /dev/null +++ b/0024-targetuserspacecreator-Respect-distro-name-in-report.patch @@ -0,0 +1,126 @@ +From 73b2a3f76e6f808c381a29253ef7e1cd5bfd4f69 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 18:11:43 +0100 +Subject: [PATCH 24/44] targetuserspacecreator: Respect distro name in report + +Also add stable report key for no base repos inhibitor. The key was +computed with 'Cannot find required basic RHEL target repositories.' as +the title. + +Jira: RHEL-130950 +--- + .../libraries/userspacegen.py | 34 ++++++++++--------- + .../tests/unit_test_targetuserspacecreator.py | 10 +++--- + 2 files changed, 23 insertions(+), 21 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py b/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py +index 7dbadae2..2475aad4 100644 +--- a/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py ++++ b/repos/system_upgrade/common/actors/targetuserspacecreator/libraries/userspacegen.py +@@ -844,9 +844,8 @@ def _inhibit_if_no_base_repos(distro_repoids): + no_baseos = all("baseos" not in ri for ri in distro_repoids) + no_appstream = all("appstream" not in ri for ri in distro_repoids) + if no_baseos or no_appstream: +- reporting.create_report([ +- # TODO: Make the report distro agnostic +- reporting.Title('Cannot find required basic RHEL target repositories.'), ++ report = [ ++ reporting.Title('Cannot find required basic target OS repositories.'), + reporting.Summary( + 'This can happen when a repository ID was entered incorrectly either while using the --enablerepo' + ' option of leapp or in a third party actor that produces a CustomTargetRepositoryMessage.' +@@ -854,17 +853,6 @@ def _inhibit_if_no_base_repos(distro_repoids): + reporting.Groups([reporting.Groups.REPOSITORY]), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.INHIBITOR]), +- reporting.Remediation(hint=( +- 'It is required to have RHEL repositories on the system' +- ' provided by the subscription-manager unless the --no-rhsm' +- ' option is specified. You might be missing a valid SKU for' +- ' the target system or have a failed network connection.' +- ' Check whether your system is attached to a valid SKU that is' +- ' providing RHEL {} repositories.' +- ' If you are using Red Hat Satellite, read the upgrade documentation' +- ' to set up Satellite and the system properly.' +- +- ).format(target_major_version)), + reporting.ExternalLink( + url='https://access.redhat.com/solutions/5392811', + title='RHEL 7 to RHEL 8 LEAPP Upgrade Failing When Using Red Hat Satellite' +@@ -874,8 +862,22 @@ def _inhibit_if_no_base_repos(distro_repoids): + # https://red.ht/preparing-for-upgrade-to-rhel9 + # https://red.ht/preparing-for-upgrade-to-rhel10 + url='https://red.ht/preparing-for-upgrade-to-rhel{}'.format(target_major_version), +- title='Preparing for the upgrade') +- ]) ++ title='Preparing for the upgrade'), ++ reporting.Key('f5770a56e540f27d370da7b697cb4a2e81e2c30d'), ++ ] ++ if get_target_distro_id() == 'rhel': ++ report.append(reporting.Remediation(hint=( ++ 'It is required to have RHEL repositories on the system' ++ ' provided by the subscription-manager unless the --no-rhsm' ++ ' option is specified. You might be missing a valid SKU for' ++ ' the target system or have a failed network connection.' ++ ' Check whether your system is attached to a valid SKU that is' ++ ' providing RHEL {} repositories.' ++ ' If you are using Red Hat Satellite, read the upgrade documentation' ++ ' to set up Satellite and the system properly.' ++ .format(target_major_version))) ++ ) ++ reporting.create_report(report) + raise StopActorExecution() + + +diff --git a/repos/system_upgrade/common/actors/targetuserspacecreator/tests/unit_test_targetuserspacecreator.py b/repos/system_upgrade/common/actors/targetuserspacecreator/tests/unit_test_targetuserspacecreator.py +index e8853979..b49eff56 100644 +--- a/repos/system_upgrade/common/actors/targetuserspacecreator/tests/unit_test_targetuserspacecreator.py ++++ b/repos/system_upgrade/common/actors/targetuserspacecreator/tests/unit_test_targetuserspacecreator.py +@@ -1103,7 +1103,7 @@ def test_gather_target_repositories_none_available(monkeypatch): + reports = [m.report for m in mocked_produce.model_instances if isinstance(m, reporting.Report)] + inhibitors = [m for m in reports if 'INHIBITOR' in m.get('flags', ())] + assert len(inhibitors) == 1 +- assert inhibitors[0].get('title', '') == 'Cannot find required basic RHEL target repositories.' ++ assert inhibitors[0].get('title', '') == 'Cannot find required basic target OS repositories.' + + + @suppress_deprecation(models.RHELTargetRepository) +@@ -1166,7 +1166,7 @@ def test_gather_target_repositories_baseos_appstream_not_available(monkeypatch): + reports = [m.report for m in mocked_produce.model_instances if isinstance(m, reporting.Report)] + inhibitors = [m for m in reports if 'inhibitor' in m.get('groups', ())] + assert len(inhibitors) == 1 +- assert inhibitors[0].get('title', '') == 'Cannot find required basic RHEL target repositories.' ++ assert inhibitors[0].get('title', '') == 'Cannot find required basic target OS repositories.' + # Now test the case when either of AppStream and BaseOs is not available, upgrade should be inhibited + mocked_produce = produce_mocked() + monkeypatch.setattr(userspacegen.api, 'current_actor', CurrentActorMocked()) +@@ -1181,7 +1181,7 @@ def test_gather_target_repositories_baseos_appstream_not_available(monkeypatch): + reports = [m.report for m in mocked_produce.model_instances if isinstance(m, reporting.Report)] + inhibitors = [m for m in reports if 'inhibitor' in m.get('groups', ())] + assert len(inhibitors) == 1 +- assert inhibitors[0].get('title', '') == 'Cannot find required basic RHEL target repositories.' ++ assert inhibitors[0].get('title', '') == 'Cannot find required basic target OS repositories.' + mocked_produce = produce_mocked() + monkeypatch.setattr(userspacegen.api, 'current_actor', CurrentActorMocked()) + monkeypatch.setattr(userspacegen.api.current_actor(), 'produce', mocked_produce) +@@ -1195,7 +1195,7 @@ def test_gather_target_repositories_baseos_appstream_not_available(monkeypatch): + reports = [m.report for m in mocked_produce.model_instances if isinstance(m, reporting.Report)] + inhibitors = [m for m in reports if 'inhibitor' in m.get('groups', ())] + assert len(inhibitors) == 1 +- assert inhibitors[0].get('title', '') == 'Cannot find required basic RHEL target repositories.' ++ assert inhibitors[0].get('title', '') == 'Cannot find required basic target OS repositories.' + + + def test__get_distro_available_repoids_norhsm_norhui(monkeypatch): +@@ -1254,7 +1254,7 @@ def test__get_distro_available_repoids_nobaserepos_inhibit( + # TODO adjust the asserts when the report is made distro agnostic + assert reporting.create_report.called == 1 + report = reporting.create_report.reports[0] +- assert "Cannot find required basic RHEL target repositories" in report["title"] ++ assert "Cannot find required basic target OS repositories" in report["title"] + assert reporting.Groups.INHIBITOR in report["groups"] + + +-- +2.53.0 + diff --git a/0025-checkdetecteddevicesanddirvers-Respect-distro-name-i.patch b/0025-checkdetecteddevicesanddirvers-Respect-distro-name-i.patch new file mode 100644 index 0000000..6ee6806 --- /dev/null +++ b/0025-checkdetecteddevicesanddirvers-Respect-distro-name-i.patch @@ -0,0 +1,241 @@ +From 8e0aad41201e080482fbc279fd2d58bc11c20e91 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 18:46:16 +0100 +Subject: [PATCH 25/44] checkdetecteddevicesanddirvers: Respect distro name in + reports + +Also add stable keys to all reports, the keys were generated as if on +7->8 upgrade (target major version == 8), the exact titles used for +computation: +- 'Leapp detected loaded kernel drivers which have been removed in RHEL 8. Upgrade cannot proceed.' +- 'Leapp detected devices which are no longer supported in RHEL 8. Upgrade cannot proceed.' +- 'Leapp detected a processor which is no longer supported in RHEL 8. Upgrade cannot proceed.' +- 'Leapp detected loaded kernel drivers which are no longer maintained in RHEL 8.' +- 'Leapp detected devices which are no longer maintained in RHEL 8' +- 'Leapp detected a processor which is no longer maintained in RHEL 8.' + +The following report titles and keys are no longer used as they've been +unified with the reports above and now also use the respective keys: + +Leapp detected loaded kernel drivers which have been removed in RHEL 9. Upgrade cannot proceed. + - 7ae2961239eec9905e2580fa6309a589b1dca953 +Leapp detected devices which are no longer supported in RHEL 9. Upgrade cannot proceed. + - 0e042eba4d14bd1f1ae691db6389621f778f21ad +Leapp detected a processor which is no longer supported in RHEL 9. Upgrade cannot proceed. + - f79672290945c09de12a14b28906b98d5c8ed68a +Leapp detected loaded kernel drivers which are no longer maintained in RHEL 9. + - b03c306f274b33b4cf3c7cd3764366c599681481 +Leapp detected devices which are no longer maintained in RHEL 9 + - 65ac6710649c928288162900e8df8316ac8e1bda +Leapp detected a processor which is no longer maintained in RHEL 9. + - 93f6cf039f01095a59ebaf581ced33316e034ef8 +Leapp detected loaded kernel drivers which have been removed in RHEL 10. Upgrade cannot proceed. + - 48e04852631245aa4afee9adcdc7c2375b8cffb8 +Leapp detected devices which are no longer supported in RHEL 10. Upgrade cannot proceed. + - fa9da5bf370c8477eb4f8366b68ffac2aaae6374 +Leapp detected a processor which is no longer supported in RHEL 10. Upgrade cannot proceed. + - f6199d8526ee41c3e89b4ed11b3f8ee90cfc6f9f +Leapp detected loaded kernel drivers which are no longer maintained in RHEL 10. + - fbb11ae5828d624c4e4c91e73d766c8e27b066d9 +Leapp detected devices which are no longer maintained in RHEL 10 + - 93f67baabd93c00625fce5ad47edbf19972e41a0 +Leapp detected a processor which is no longer maintained in RHEL 10. + - 9dde4bcd8b458bd6803462216785df3a1476c1f8 + +Jira: RHEL-130950 +--- + .../libraries/checkdddd.py | 70 +++++++++++-------- + 1 file changed, 41 insertions(+), 29 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkdetecteddevicesanddrivers/libraries/checkdddd.py b/repos/system_upgrade/common/actors/checkdetecteddevicesanddrivers/libraries/checkdddd.py +index 1f01adde..22a39c29 100644 +--- a/repos/system_upgrade/common/actors/checkdetecteddevicesanddrivers/libraries/checkdddd.py ++++ b/repos/system_upgrade/common/actors/checkdetecteddevicesanddrivers/libraries/checkdddd.py +@@ -3,6 +3,7 @@ from enum import IntEnum + + from leapp import reporting + from leapp.libraries.common.config.version import get_source_major_version, get_target_major_version ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import DetectedDeviceOrDriver + +@@ -22,17 +23,19 @@ def create_inhibitors(inhibiting_entries): + if drivers: + reporting.create_report([ + reporting.Title( +- 'Leapp detected loaded kernel drivers which have been removed ' +- 'in RHEL {}. Upgrade cannot proceed.'.format(get_target_major_version()) ++ 'Leapp detected loaded kernel drivers that have been removed in' ++ ' the target OS. Upgrade cannot proceed.' + ), + reporting.Summary( + ( +- 'Support for the following RHEL {source} device drivers has been removed in RHEL {target}:\n' ++ 'Support for the following {source_distro} {source_version} device drivers has' ++ ' been removed in {target_distro} {target_version}:\n' + ' - {drivers}\n' + ).format( + drivers='\n - '.join([entry.driver_name for entry in drivers]), +- target=get_target_major_version(), +- source=get_source_major_version(), ++ target_version=get_target_major_version(), ++ source_version=get_source_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.ExternalLink( +@@ -52,52 +55,57 @@ def create_inhibitors(inhibiting_entries): + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL, reporting.Groups.DRIVERS]), + reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.INHIBITOR]) ++ reporting.Groups([reporting.Groups.INHIBITOR]), ++ reporting.Key('f08a07da902958defa4f5c2699fae9ec2eb67c5b'), + ]) + + devices = inhibiting_entries.get(MessagingClass.DEVICES) + if devices: + reporting.create_report([ + reporting.Title( +- 'Leapp detected devices which are no longer supported in RHEL {}. Upgrade cannot proceed.'.format( +- get_target_major_version()) ++ 'Leapp detected devices no longer supported by the target OS.' ++ ' Upgrade cannot proceed.' + ), + reporting.Summary( + ( +- 'Support for the following devices has been removed in RHEL {target}:\n' ++ 'Support for the following devices has been removed in {target_distro} {version}:\n' + ' - {devices}\n' + ).format( + devices='\n - '.join(['{name} ({pci})'.format(name=entry.device_name, + pci=entry.device_id) for entry in devices]), +- target=get_target_major_version(), ++ version=get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL]), + reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.INHIBITOR]) ++ reporting.Groups([reporting.Groups.INHIBITOR]), ++ reporting.Key('ccfc28592c82123649fc824c6c1c89cabfceae7c'), + ]) + + cpus = inhibiting_entries.get(MessagingClass.CPUS) + if cpus: + reporting.create_report([ + reporting.Title( +- 'Leapp detected a processor which is no longer supported in RHEL {}. Upgrade cannot proceed.'.format( +- get_target_major_version()) ++ 'Leapp detected a processor no longer supported by the target OS.' ++ ' Upgrade cannot proceed.' + ), + reporting.Summary( + ( +- 'Support for the following processors has been removed in RHEL {target}:\n' ++ 'Support for the following processors has been removed in {target_distro} {version}:\n' + ' - {processors}\n' + ).format( + processors='\n - '.join([entry.device_name for entry in cpus]), +- target=get_target_major_version(), ++ version=get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL, reporting.Groups.BOOT]), + reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.INHIBITOR]) ++ reporting.Groups([reporting.Groups.INHIBITOR]), ++ reporting.Key('e3e9e4d2566733e2f843db9823c8568b9b6922f9'), + ]) + + +@@ -109,65 +117,69 @@ def create_warnings(unmaintained_entries): + if drivers: + reporting.create_report([ + reporting.Title( +- 'Leapp detected loaded kernel drivers which are no longer maintained in RHEL {}.'.format( +- get_target_major_version()) ++ 'Leapp detected loaded kernel drivers no longer maintained in the target OS' + ), + reporting.Summary( + ( +- 'The following RHEL {source} device drivers are no longer maintained RHEL {target}:\n' ++ 'The following {source_distro} {source_version} device drivers are no longer' ++ ' maintained {target_distro} {target_version}:\n' + ' - {drivers}\n' + ).format( + drivers='\n - '.join([entry.driver_name for entry in drivers]), +- target=get_target_major_version(), +- source=get_source_major_version(), ++ target_version=get_target_major_version(), ++ source_version=get_source_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL, reporting.Groups.DRIVERS]), + reporting.Severity(reporting.Severity.HIGH), ++ reporting.Key('0ff2413fd3cb0358736bf9be597f4dbdf58f2c4d'), + ]) + + devices = unmaintained_entries.get(MessagingClass.DEVICES) + if devices: + reporting.create_report([ + reporting.Title( +- 'Leapp detected devices which are no longer maintained in RHEL {}'.format( +- get_target_major_version()) ++ 'Leapp detected devices no longer maintained in the target OS' + ), + reporting.Summary( + ( +- 'The support for the following devices has been removed in RHEL {target} and ' ++ 'The support for the following devices has been removed in {target_distro} {version} and ' + 'are no longer maintained:\n - {devices}\n' + ).format( + devices='\n - '.join(['{name} ({pci})'.format(name=entry.device_name, + pci=entry.device_id) for entry in devices]), +- target=get_target_major_version(), ++ version=get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL]), + reporting.Severity(reporting.Severity.HIGH), ++ reporting.Key('261e3e55a3a80346f2fcc2a1e59c64f7a4caa263'), + ]) + + cpus = unmaintained_entries.get(MessagingClass.CPUS) + if cpus: + reporting.create_report([ + reporting.Title( +- 'Leapp detected a processor which is no longer maintained in RHEL {}.'.format( +- get_target_major_version()) ++ 'Leapp detected a processor no longer maintained in the target OS' + ), + reporting.Summary( + ( +- 'The following processors are no longer maintained in RHEL {target}:\n' ++ 'The following processors are no longer maintained in {target_distro} {version}:\n' + ' - {processors}\n' + ).format( + processors='\n - '.join([entry.device_name for entry in cpus]), +- target=get_target_major_version(), ++ version=get_target_major_version(), ++ **DISTRO_REPORT_NAMES + ) + ), + reporting.Audience('sysadmin'), + reporting.Groups([reporting.Groups.KERNEL, reporting.Groups.BOOT]), + reporting.Severity(reporting.Severity.HIGH), ++ reporting.Key('61eb181bbc56328fbe03b5229d25a8ea5ebdc7a2'), + ]) + + +-- +2.53.0 + diff --git a/0026-reportleftoverpackages-Respect-distro-name-in-report.patch b/0026-reportleftoverpackages-Respect-distro-name-in-report.patch new file mode 100644 index 0000000..956d22e --- /dev/null +++ b/0026-reportleftoverpackages-Respect-distro-name-in-report.patch @@ -0,0 +1,140 @@ +From e9fa8aac4b32baaaf171c1cd6cd25f88a78d36a0 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Mon, 2 Mar 2026 19:01:02 +0100 +Subject: [PATCH 26/44] reportleftoverpackages: Respect distro name in reports + +The actors is also moved from the reportleftoverpackages actor +subdirectory to the root actor directory. + +Also add stable report keys to the reports. The keys were computed using +titles: +- 'Leftover RHEL packages have been removed' +- 'Some RHEL packages have not been upgraded' + +Jira: RHEL-130950 +--- + .../{reportleftoverpackages => }/actor.py | 8 ++++---- + .../libraries/reportleftoverpackages.py | 17 +++++++++++------ + .../tests/test_reportleftoverpackages.py | 9 ++++++--- + 3 files changed, 21 insertions(+), 13 deletions(-) + rename repos/system_upgrade/common/actors/reportleftoverpackages/{reportleftoverpackages => }/actor.py (61%) + rename repos/system_upgrade/common/actors/reportleftoverpackages/{reportleftoverpackages => }/libraries/reportleftoverpackages.py (73%) + rename repos/system_upgrade/common/actors/reportleftoverpackages/{reportleftoverpackages => }/tests/test_reportleftoverpackages.py (86%) + +diff --git a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/actor.py b/repos/system_upgrade/common/actors/reportleftoverpackages/actor.py +similarity index 61% +rename from repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/actor.py +rename to repos/system_upgrade/common/actors/reportleftoverpackages/actor.py +index 58573451..d0640774 100644 +--- a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/actor.py ++++ b/repos/system_upgrade/common/actors/reportleftoverpackages/actor.py +@@ -7,11 +7,11 @@ from leapp.tags import IPUWorkflowTag, RPMUpgradePhaseTag + + class ReportLeftoverPackages(Actor): + """ +- Collect messages about leftover RHEL packages from older major versions and generate a report. ++ Generate a report about leftover distribution packages from older major versions. + +- Depending on execution of previous actors, +- generated report contains information that there are still old RHEL packages +- present on the system, which makes it unsupported or lists packages that have been removed. ++ Generated report informs about old distribution packages present on the system, ++ which makes it unsupported, and lists packages that have been removed if there ++ were any. + """ + + name = 'report_leftover_packages' +diff --git a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/libraries/reportleftoverpackages.py b/repos/system_upgrade/common/actors/reportleftoverpackages/libraries/reportleftoverpackages.py +similarity index 73% +rename from repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/libraries/reportleftoverpackages.py +rename to repos/system_upgrade/common/actors/reportleftoverpackages/libraries/reportleftoverpackages.py +index 51bda931..cd45ac87 100644 +--- a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/libraries/reportleftoverpackages.py ++++ b/repos/system_upgrade/common/actors/reportleftoverpackages/libraries/reportleftoverpackages.py +@@ -1,4 +1,5 @@ + from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES + from leapp.libraries.stdlib import api + from leapp.models import LeftoverPackages, RemovedPackages + +@@ -11,15 +12,16 @@ def process(): + leftover_pkgs_to_remove = ['-'.join([pkg.name, pkg.version, pkg.release]) for pkg in leftover_packages.items] + + if removed_packages and removed_packages.items: +- title = 'Leftover RHEL packages have been removed' ++ title = 'Leftover packages from the original OS have been removed' + removed = ['-'.join([pkg.name, pkg.version, pkg.release]) for pkg in removed_packages.items] + summary = ( +- 'Following packages have been removed:{sep}{list}\n' ++ 'Following {source_distro} packages have been removed:{sep}{list}\n' + 'Dependent packages may have been removed as well, please check that you are not missing ' + 'any packages.' + .format( + sep=FMT_LIST_SEPARATOR, +- list=FMT_LIST_SEPARATOR.join(removed) ++ list=FMT_LIST_SEPARATOR.join(removed), ++ **DISTRO_REPORT_NAMES + ) + ) + reporting.create_report([ +@@ -27,23 +29,26 @@ def process(): + reporting.Summary(summary), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SANITY]), ++ reporting.Key('5afbad560709afa4e40a160e40dfd44788ba9c3b'), + ] + [reporting.RelatedResource('package', pkg.name) for pkg in removed_packages.items]) + return + + if leftover_packages and leftover_packages.items: + summary = ( +- 'Following RHEL packages have not been upgraded:{sep}{list}\n' ++ 'Following {source_distro} packages have not been upgraded:{sep}{list}\n' + 'Please remove these packages to keep your system in supported state.' + .format( + sep=FMT_LIST_SEPARATOR, +- list=FMT_LIST_SEPARATOR.join(leftover_pkgs_to_remove) ++ list=FMT_LIST_SEPARATOR.join(leftover_pkgs_to_remove), ++ **DISTRO_REPORT_NAMES + ) + ) + reporting.create_report([ +- reporting.Title('Some RHEL packages have not been upgraded'), ++ reporting.Title('Some packages from the original OS have not been upgraded'), + reporting.Summary(summary), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.SANITY]), ++ reporting.Key('d424c3132ed78a8632b5c73d919909e453107c06'), + ] + [reporting.RelatedResource('package', pkg.name) for pkg in leftover_packages.items]) + else: + api.current_logger().info('No leftover packages, skipping...') +diff --git a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/tests/test_reportleftoverpackages.py b/repos/system_upgrade/common/actors/reportleftoverpackages/tests/test_reportleftoverpackages.py +similarity index 86% +rename from repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/tests/test_reportleftoverpackages.py +rename to repos/system_upgrade/common/actors/reportleftoverpackages/tests/test_reportleftoverpackages.py +index ff493c57..9502bfd2 100644 +--- a/repos/system_upgrade/common/actors/reportleftoverpackages/reportleftoverpackages/tests/test_reportleftoverpackages.py ++++ b/repos/system_upgrade/common/actors/reportleftoverpackages/tests/test_reportleftoverpackages.py +@@ -27,7 +27,10 @@ def test_no_removed_packages_leftover_present(monkeypatch): + reportleftoverpackages.process() + + assert reporting.create_report.called == 1 +- assert 'Some RHEL packages have not been upgraded' in reporting.create_report.report_fields['title'] ++ assert ( ++ 'Some packages from the original OS have not been upgraded' ++ in reporting.create_report.report_fields['title'] ++ ) + assert 'Following RHEL packages have not been upgraded' in reporting.create_report.report_fields['summary'] + summary = 'Please remove these packages to keep your system in supported state.' + assert summary in reporting.create_report.report_fields['summary'] +@@ -44,6 +47,6 @@ def test_removed_packages(monkeypatch): + reportleftoverpackages.process() + + assert reporting.create_report.called == 1 +- assert 'Leftover RHEL packages have been removed' in reporting.create_report.report_fields['title'] +- assert 'Following packages have been removed' in reporting.create_report.report_fields['summary'] ++ assert 'Leftover packages from the original OS have been removed' in reporting.create_report.report_fields['title'] ++ assert 'Following RHEL packages have been removed' in reporting.create_report.report_fields['summary'] + assert 'rpm-1.0-1.el7' in reporting.create_report.report_fields['summary'] +-- +2.53.0 + diff --git a/0027-fix-overlaygen-exclude-hugetlbfs-from-overlay-mounts.patch b/0027-fix-overlaygen-exclude-hugetlbfs-from-overlay-mounts.patch new file mode 100644 index 0000000..7570ad4 --- /dev/null +++ b/0027-fix-overlaygen-exclude-hugetlbfs-from-overlay-mounts.patch @@ -0,0 +1,32 @@ +From 9f0cbbcb5a75f77b226cf385b6179f93fbdf9bc0 Mon Sep 17 00:00:00 2001 +From: Sergii Golovatiuk +Date: Wed, 18 Mar 2026 17:19:38 +0100 +Subject: [PATCH 27/44] fix(overlaygen): exclude hugetlbfs from overlay mounts + +hugetlbfs should not be mounted in the overlay environment during the +upgrade. It's not a regular mount point. This patch adds it to the +OVERLAY_DO_NOT_MOUNT exclusion list. + +Resolves: RHEL-156902 + +Signed-off-by: Sergii Golovatiuk +--- + repos/system_upgrade/common/libraries/overlaygen.py | 2 +- + 1 file changed, 1 insertion(+), 1 deletion(-) + +diff --git a/repos/system_upgrade/common/libraries/overlaygen.py b/repos/system_upgrade/common/libraries/overlaygen.py +index 3091ab5b..9fdaadf9 100644 +--- a/repos/system_upgrade/common/libraries/overlaygen.py ++++ b/repos/system_upgrade/common/libraries/overlaygen.py +@@ -10,7 +10,7 @@ from leapp.libraries.common.config import get_env + from leapp.libraries.common.config.version import get_target_major_version + from leapp.libraries.stdlib import api, CalledProcessError, run + +-OVERLAY_DO_NOT_MOUNT = ('tmpfs', 'devtmpfs', 'devpts', 'sysfs', 'proc', 'cramfs', 'sysv', 'vfat') ++OVERLAY_DO_NOT_MOUNT = ('tmpfs', 'devtmpfs', 'devpts', 'sysfs', 'proc', 'cramfs', 'sysv', 'vfat', 'hugetlbfs') + + # NOTE(pstodulk): what about using more closer values and than just multiply + # the final result by magical constant?... this number is most likely going to +-- +2.53.0 + diff --git a/0028-biosdevname-Fix-check-of-naming-scheme-and-tests.patch b/0028-biosdevname-Fix-check-of-naming-scheme-and-tests.patch new file mode 100644 index 0000000..d54a4e3 --- /dev/null +++ b/0028-biosdevname-Fix-check-of-naming-scheme-and-tests.patch @@ -0,0 +1,121 @@ +From 4c303cb3d30f891aa5d5d3ff4b3675deb41c6385 Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Mon, 16 Mar 2026 23:10:49 +0100 +Subject: [PATCH 28/44] biosdevname: Fix check of naming scheme and tests + +The original check matched also NIC names with suffixes that do not +correspond to biosdevname naming scheme (e.g. "em0net"). Make the +check strict for the whole ^string$ and update tests to cover the +scenario. + +Also I made small refactorings in tests +* so in case of failure it's visible what input data caused the + failure +* minimize changes needed to do with planned update of Interface model +--- + .../biosdevname/libraries/biosdevname.py | 4 +- + .../biosdevname/tests/test_biosdevname.py | 73 ++++++++----------- + 2 files changed, 31 insertions(+), 46 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/biosdevname/libraries/biosdevname.py b/repos/system_upgrade/common/actors/biosdevname/libraries/biosdevname.py +index a6b4a242..e2f4b1d1 100644 +--- a/repos/system_upgrade/common/actors/biosdevname/libraries/biosdevname.py ++++ b/repos/system_upgrade/common/actors/biosdevname/libraries/biosdevname.py +@@ -27,8 +27,8 @@ def is_vendor_dell(): + + def all_interfaces_biosdevname(interfaces): + # Biosdevname supports two naming schemes +- emx = re.compile('em[0-9]+') +- pxpy = re.compile('p[0-9]+p[0-9]+') ++ emx = re.compile('^em[0-9]+$') ++ pxpy = re.compile('^p[0-9]+p[0-9]+$') + + for i in interfaces: + if emx.match(i.name) is None and pxpy.match(i.name) is None: +diff --git a/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py b/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py +index 427eea54..3aa8c614 100644 +--- a/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py ++++ b/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py +@@ -59,50 +59,35 @@ def test_is_vendor_is_not_dell(monkeypatch): + assert not biosdevname.is_vendor_dell() + + +-def test_all_interfaces_biosdevname(monkeypatch): +- pci_info = PCIAddress(domain="domain", function="function", bus="bus", device="device") +- +- interfaces = [ +- Interface( +- name="eth0", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ) +- ] +- assert not biosdevname.all_interfaces_biosdevname(interfaces) +- interfaces = [ +- Interface( +- name="em0", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ) +- ] +- assert biosdevname.all_interfaces_biosdevname(interfaces) +- interfaces = [ +- Interface( +- name="p0p22", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ) +- ] +- assert biosdevname.all_interfaces_biosdevname(interfaces) +- +- interfaces = [ +- Interface( +- name="p1p2", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ), +- Interface( +- name="em2", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ), +- ] +- assert biosdevname.all_interfaces_biosdevname(interfaces) +- +- interfaces = [ +- Interface( +- name="p1p2", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ), +- Interface( +- name="em2", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ), +- Interface( +- name="eth0", mac="mac", vendor="dell", pci_info=pci_info, devpath="path", driver="drv" +- ), +- ] +- assert not biosdevname.all_interfaces_biosdevname(interfaces) ++def _gen_ifaces_by_names(names): ++ pci = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") ++ interfaces = [] ++ for nic_name in names: ++ interfaces.append(Interface( ++ name=nic_name, ++ devpath="path", ++ driver="drv", ++ mac="52:54:00:0b:4a:6d", ++ pci_info=pci, ++ vendor="dell", ++ )) ++ return interfaces ++ ++ ++@pytest.mark.parametrize(("interface_names", "expected_result"), ( ++ (["eth0"], False), ++ (["preem0"], False), ++ (["em0post"], False), ++ (["prep0p22"], False), ++ (["p0p22post"], False), ++ (["em0"], True), ++ (["p0p22"], True), ++ (["em2", "p1p22"], True), ++ (["p1p2", "em2", "eth0"], False) ++)) ++def test_all_interfaces_biosdevname(interface_names, expected_result): ++ interfaces = _gen_ifaces_by_names(interface_names) ++ assert biosdevname.all_interfaces_biosdevname(interfaces) == expected_result + + + def test_enable_biosdevname(monkeypatch): +-- +2.53.0 + diff --git a/0029-persistentnetnamesdisable-refactoring-fix-ethX-detec.patch b/0029-persistentnetnamesdisable-refactoring-fix-ethX-detec.patch new file mode 100644 index 0000000..9615eff --- /dev/null +++ b/0029-persistentnetnamesdisable-refactoring-fix-ethX-detec.patch @@ -0,0 +1,340 @@ +From 8d8774c34518a6269d56f100c2fc312ec0bbbde1 Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Fri, 13 Mar 2026 16:15:20 +0100 +Subject: [PATCH 29/44] persistentnetnamesdisable: refactoring + fix ethX + detection + +The original check of ethX interfaces was buggy as it detected all +interfaces with the eth[0-9] substring: + * eth0 + * preeth0 + * eth0post + ... +The check has been corrected to search just for ethX kernel names, +skipping NIC names with additional prefixes or suffixes. Added test +for the ethX_count function. Tests have been slightly refactored to +minimize planned changes in the Interface model. + +Also the actor has been originally executed in incorrect phase. +Moving the actor to CheckPhase where it should be. Also I refactorred +the actor a little bit, moving the code to the private library to +follow current best practices. + +Jira: RHEL-3370 +--- + .../actors/persistentnetnamesdisable/actor.py | 63 +---------- + .../libraries/persistentnetnamesdisable.py | 75 +++++++++++++ + .../tests/test_persistentnetnamesdisable.py | 104 ++++++++++++++---- + 3 files changed, 163 insertions(+), 79 deletions(-) + create mode 100644 repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py + +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +index b0182982..15c43141 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +@@ -1,11 +1,8 @@ +-import re +- +-from leapp import reporting + from leapp.actors import Actor +-from leapp.libraries.common.config.version import get_target_major_version ++from leapp.libraries.actor import persistentnetnamesdisable + from leapp.models import KernelCmdlineArg, PersistentNetNamesFacts +-from leapp.reporting import create_report, Report +-from leapp.tags import FactsPhaseTag, IPUWorkflowTag ++from leapp.reporting import Report ++from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + + + class PersistentNetNamesDisable(Actor): +@@ -16,57 +13,7 @@ class PersistentNetNamesDisable(Actor): + name = 'persistentnetnamesdisable' + consumes = (PersistentNetNamesFacts,) + produces = (KernelCmdlineArg, Report) +- tags = (FactsPhaseTag, IPUWorkflowTag) +- +- @staticmethod +- def ethX_count(interfaces): +- ethX = re.compile('eth[0-9]+') +- count = 0 +- +- for i in interfaces: +- if ethX.match(i.name): +- count = count + 1 +- return count +- +- @staticmethod +- def single_eth0(interfaces): +- return len(interfaces) == 1 and interfaces[0].name == 'eth0' +- +- def disable_persistent_naming(self): +- self.log.info("Single eth0 network interface detected. Appending 'net.ifnames=0' to RHEL-8 kernel commandline") +- self.produce(KernelCmdlineArg(**{'key': 'net.ifnames', 'value': '0'})) ++ tags = (ChecksPhaseTag, IPUWorkflowTag) + + def process(self): +- interfaces = next(self.consume(PersistentNetNamesFacts)).interfaces +- +- if self.single_eth0(interfaces): +- self.disable_persistent_naming() +- elif len(interfaces) > 1 and self.ethX_count(interfaces) > 0: +- report_entries = [ +- reporting.Title('Unsupported network configuration'), +- reporting.Summary( +- 'Detected multiple physical network interfaces where one or more use kernel naming (e.g. eth0). ' +- 'Upgrade process can not continue because stability of names can not be guaranteed. ' +- ), +- reporting.ExternalLink( +- title='How to Perform an In-Place Upgrade when Using Kernel-Assigned NIC Names', +- url='https://access.redhat.com/solutions/4067471' +- ), +- reporting.Remediation( +- hint='Rename all ethX network interfaces following the attached KB solution article.' +- ), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.NETWORK]), +- reporting.Groups([reporting.Groups.INHIBITOR]) +- ] +- +- if get_target_major_version() == '9': +- report_entries.append( +- reporting.ExternalLink( +- title='RHEL 8 to RHEL 9: inplace upgrade fails at ' +- '"Network configuration for unsupported device types detected"', +- url='https://access.redhat.com/solutions/7009239' +- ) +- ) +- +- create_report(report_entries) ++ persistentnetnamesdisable.process() +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +new file mode 100644 +index 00000000..0d1a90e2 +--- /dev/null ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +@@ -0,0 +1,75 @@ ++import re ++ ++from leapp import reporting ++from leapp.libraries.common.config.version import get_target_major_version ++from leapp.libraries.stdlib import api ++from leapp.models import KernelCmdlineArg, PersistentNetNamesFacts ++from leapp.reporting import create_report ++ ++ ++def ethX_count(interfaces): ++ """ ++ Count how many network interfaces with ethX naming is present. ++ """ ++ ethX = re.compile('^eth[0-9]+$') ++ count = 0 ++ ++ for i in interfaces: ++ if ethX.match(i.name): ++ count = count + 1 ++ return count ++ ++ ++def single_eth0(interfaces): ++ return len(interfaces) == 1 and interfaces[0].name == 'eth0' ++ ++ ++def disable_persistent_naming(): ++ api.current_logger().info( ++ "Single eth0 network interface detected." ++ " Appending 'net.ifnames=0' for the target system kernel commandline" ++ ) ++ api.produce(KernelCmdlineArg(**{'key': 'net.ifnames', 'value': '0'})) ++ ++ ++def report_ethX_ifaces(): ++ report_entries = [ ++ reporting.Title('Unsupported network configuration'), ++ reporting.Summary( ++ 'Detected multiple physical network interfaces where one or more' ++ ' use kernel naming (e.g. eth0). Upgrade process cannot continue' ++ ' because stability of names can not be guaranteed.' ++ ), ++ reporting.ExternalLink( ++ title='How to Perform an In-Place Upgrade when Using Kernel-Assigned NIC Names', ++ url='https://access.redhat.com/solutions/4067471' ++ ), ++ reporting.Remediation( ++ hint='Rename all ethX network interfaces following the attached KB solution article.' ++ ), ++ reporting.Severity(reporting.Severity.HIGH), ++ reporting.Groups([reporting.Groups.NETWORK]), ++ reporting.Groups([reporting.Groups.INHIBITOR]) ++ ] ++ ++ if get_target_major_version() == '9': ++ report_entries.append( ++ reporting.ExternalLink( ++ title='RHEL 8 to RHEL 9: inplace upgrade fails at ' ++ '"Network configuration for unsupported device types detected"', ++ url='https://access.redhat.com/solutions/7009239' ++ ) ++ ) ++ ++ create_report(report_entries) ++ ++ ++def process(): ++ interfaces = next(api.consume(PersistentNetNamesFacts)).interfaces ++ ++ if single_eth0(interfaces): ++ disable_persistent_naming() ++ return ++ ++ if len(interfaces) > 1 and ethX_count(interfaces): ++ report_ethX_ifaces() +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +index 95b695c0..2369e80f 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +@@ -1,17 +1,53 @@ + import pytest + +-from leapp.libraries.common.config import version ++from leapp.libraries.actor import persistentnetnamesdisable + from leapp.models import Interface, KernelCmdlineArg, PCIAddress, PersistentNetNamesFacts + from leapp.reporting import Report + from leapp.snactor.fixture import current_actor_context + from leapp.utils.report import is_inhibitor + + ++def _gen_ifaces_by_names(names): ++ pci = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") ++ interfaces = [] ++ for nic_name in names: ++ interfaces.append(Interface( ++ name=nic_name, ++ devpath="/devices/platform/usb/cdc-wdm0", ++ driver="pcieport", ++ mac="52:54:00:0b:4a:6d", ++ pci_info=pci, ++ vendor="redhat", ++ )) ++ return interfaces ++ ++ ++@pytest.mark.parametrize(('interfaces', 'exp_result'), ( ++ (_gen_ifaces_by_names(['eno1', 'eno2', 'myfoo00', 'nicname']), 0), ++ (_gen_ifaces_by_names(['preeth0', 'eth2post', 'preeth0post']), 0), ++ (_gen_ifaces_by_names(['eth0']), 1), ++ (_gen_ifaces_by_names(['eth0', 'eth1', 'eth01', 'eth4980']), 4), ++ (_gen_ifaces_by_names(['myeth0', 'eth0', 'something']), 1), ++)) ++def test_ethX_count(interfaces, exp_result): ++ """ ++ Test the correct detection of ethX interfaces. ++ ++ It tests the bug causing https://issues.redhat.com/browse/RHEL-3370 ++ """ ++ assert persistentnetnamesdisable.ethX_count(interfaces) == exp_result ++ ++ + def test_actor_single_eth0(current_actor_context): + pci = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") +- interface = [Interface(name="eth0", mac="52:54:00:0b:4a:6d", vendor="redhat", +- driver="pcieport", pci_info=pci, +- devpath="/devices/platform/usb/cdc-wdm0")] ++ interface = [Interface( ++ name="eth0", ++ mac="52:54:00:0b:4a:6d", ++ vendor="redhat", ++ driver="pcieport", ++ pci_info=pci, ++ devpath="/devices/platform/usb/cdc-wdm0" ++ )] + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) + current_actor_context.run() + assert not current_actor_context.consume(Report) +@@ -21,15 +57,25 @@ def test_actor_single_eth0(current_actor_context): + 'target_version', ['9', '10'] + ) + def test_actor_more_ethX(monkeypatch, current_actor_context, target_version): +- monkeypatch.setattr(version, 'get_target_major_version', lambda: target_version) ++ monkeypatch.setattr(persistentnetnamesdisable, 'get_target_major_version', lambda: target_version) + pci1 = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") + pci2 = PCIAddress(domain="0000", bus="3d", function="00", device="Serial controller") +- interface = [Interface(name="eth0", mac="52:54:00:0b:4a:6d", vendor="redhat", +- driver="pcieport", pci_info=pci1, +- devpath="/devices/platform/usb/cdc-wdm0"), +- Interface(name="eth1", mac="52:54:00:0b:4a:6a", vendor="redhat", +- driver="serial", pci_info=pci2, +- devpath="/devices/hidraw/hidraw0")] ++ interface = [ ++ Interface( ++ name="eth0", ++ mac="52:54:00:0b:4a:6d", ++ vendor="redhat", ++ driver="pcieport", ++ pci_info=pci1, ++ devpath="/devices/platform/usb/cdc-wdm0"), ++ Interface( ++ name="eth1", ++ mac="52:54:00:0b:4a:6a", ++ vendor="redhat", ++ driver="serial", ++ pci_info=pci2, ++ devpath="/devices/hidraw/hidraw0") ++ ] + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) + current_actor_context.run() + +@@ -50,9 +96,15 @@ def test_actor_more_ethX(monkeypatch, current_actor_context, target_version): + + def test_actor_single_int_not_ethX(current_actor_context): + pci = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") +- interface = [Interface(name="tap0", mac="52:54:00:0b:4a:60", vendor="redhat", +- driver="pcieport", pci_info=pci, +- devpath="/devices/platform/usb/cdc-wdm0")] ++ interface = [ ++ Interface( ++ name="tap0", ++ mac="52:54:00:0b:4a:60", ++ vendor="redhat", ++ driver="pcieport", ++ pci_info=pci, ++ devpath="/devices/platform/usb/cdc-wdm0") ++ ] + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) + current_actor_context.run() + assert not current_actor_context.consume(Report) +@@ -62,15 +114,25 @@ def test_actor_single_int_not_ethX(current_actor_context): + 'target_version', ['9', '10'] + ) + def test_actor_ethX_and_not_ethX(monkeypatch, current_actor_context, target_version): +- monkeypatch.setattr(version, 'get_target_major_version', lambda: target_version) ++ monkeypatch.setattr(persistentnetnamesdisable, 'get_target_major_version', lambda: target_version) + pci1 = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") + pci2 = PCIAddress(domain="0000", bus="3d", function="00", device="Serial controller") +- interface = [Interface(name="virbr0", mac="52:54:00:0b:4a:6d", vendor="redhat", +- driver="pcieport", pci_info=pci1, +- devpath="/devices/platform/usb/cdc-wdm0"), +- Interface(name="eth0", mac="52:54:00:0b:4a:6a", vendor="redhat", +- driver="serial", pci_info=pci2, +- devpath="/devices/hidraw/hidraw0")] ++ interface = [ ++ Interface( ++ name="virbr0", ++ mac="52:54:00:0b:4a:6d", ++ vendor="redhat", ++ driver="pcieport", ++ pci_info=pci1, ++ devpath="/devices/platform/usb/cdc-wdm0"), ++ Interface( ++ name="eth0", ++ mac="52:54:00:0b:4a:6a", ++ vendor="redhat", ++ driver="serial", ++ pci_info=pci2, ++ devpath="/devices/hidraw/hidraw0") ++ ] + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) + current_actor_context.run() + assert current_actor_context.consume(Report) +-- +2.53.0 + diff --git a/0030-Fix-scan-of-net-interfaces-non-PCI-conflicting-broke.patch b/0030-Fix-scan-of-net-interfaces-non-PCI-conflicting-broke.patch new file mode 100644 index 0000000..4f41a2f --- /dev/null +++ b/0030-Fix-scan-of-net-interfaces-non-PCI-conflicting-broke.patch @@ -0,0 +1,518 @@ +From cdbb91156d1b87883523eed476c9a5d16b4b4e20 Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Wed, 21 Feb 2024 20:55:54 +0100 +Subject: [PATCH 30/44] Fix scan of net interfaces: non-PCI, conflicting, + broken +MIME-Version: 1.0 +Content-Type: text/plain; charset=UTF-8 +Content-Transfer-Encoding: 8bit + +Non-PCI network devices (present usually on IBM Z architecture) +does not have ID_VENDOR_ID attribute and also there is nothing +we could put into Interface.pci_info about them. +For such devices: + * set empty string for Interface.vendor field + * and None value for pci_info. +The Interface model has been updated, allowing None value for +pci_info field. + +Also some interfaces do not have to be "managed" by udev or can +provide incomplete data. This can happen e.g. in situations when +udev want to assign a NIC name that is already used by another +network interface. Such an interface stays with kernel name (ethX) +and udev DB contains only elementary information about it. This +led originally to a skip of the interface during system scanning +by leapp actors and such systems bypassed checks for presence of +ethX NIC names later. Usually such interfaces have been renamed after +the upgrade (either to a new non-ethX name, or they had a different +ethX value) which led to another issues. + +The new solution requires just bare-minimum details to be always +present (like NIC name and device path; if missing, the skip is used +again). For other values we set an empty strings if missing. + +Tests have been updated and extended to cover new changes, using +mainly real input data collected from affected systems. + +Jira: RHEL-22371, RHEL-72140 + +Co-authored-by: Michal Hečko +--- + .../tests/test_persistentnetnames.py | 5 + + .../tests/test_persistentnetnamesinitramfs.py | 6 + + .../common/libraries/persistentnetnames.py | 35 ++- + .../tests/test_persistentnetnames_library.py | 243 ++++++++++++++++-- + .../common/models/persistentnetnamesfacts.py | 57 +++- + 5 files changed, 314 insertions(+), 32 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/persistentnetnames/tests/test_persistentnetnames.py b/repos/system_upgrade/common/actors/persistentnetnames/tests/test_persistentnetnames.py +index ffea5983..a47eeabe 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnames/tests/test_persistentnetnames.py ++++ b/repos/system_upgrade/common/actors/persistentnetnames/tests/test_persistentnetnames.py +@@ -32,6 +32,11 @@ class interfaces_mocked: + + @pytest.mark.parametrize('count', [0, 1, 8, 256]) + def test_run(monkeypatch, current_actor_context, count): ++ """ ++ Basic test of interface scanner actor ++ ++ Full testing of underlying function is covered in tests of common library. ++ """ + monkeypatch.setattr(persistentnetnames, 'interfaces', interfaces_mocked(count)) + current_actor_context.run() + assert len(current_actor_context.consume(PersistentNetNamesFacts)[0].interfaces) == count +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesinitramfs/tests/test_persistentnetnamesinitramfs.py b/repos/system_upgrade/common/actors/persistentnetnamesinitramfs/tests/test_persistentnetnamesinitramfs.py +index f149502b..5605af4b 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesinitramfs/tests/test_persistentnetnamesinitramfs.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesinitramfs/tests/test_persistentnetnamesinitramfs.py +@@ -32,6 +32,12 @@ class interfaces_mocked: + + @pytest.mark.parametrize('count', [0, 1, 8, 256]) + def test_run(monkeypatch, current_actor_context, count): ++ """ ++ Basic functionality test. ++ ++ The full testing of the underlying scanner function is covered by the common ++ library. ++ """ + monkeypatch.setattr(persistentnetnames, 'interfaces', interfaces_mocked(count)) + current_actor_context.run() + assert len(current_actor_context.consume(PersistentNetNamesFactsInitramfs)[0].interfaces) == count +diff --git a/repos/system_upgrade/common/libraries/persistentnetnames.py b/repos/system_upgrade/common/libraries/persistentnetnames.py +index 7fdf7eaa..48dee5f8 100644 +--- a/repos/system_upgrade/common/libraries/persistentnetnames.py ++++ b/repos/system_upgrade/common/libraries/persistentnetnames.py +@@ -41,16 +41,41 @@ def interfaces(): + try: + attrs['name'] = dev.sys_name + attrs['devpath'] = dev.device_path +- attrs['driver'] = dev['ID_NET_DRIVER'] +- attrs['vendor'] = dev['ID_VENDOR_ID'] +- attrs['pci_info'] = PCIAddress(**pci_info(dev['ID_PATH'])) +- attrs['mac'] = dev.attributes.get('address') ++ ++ # can be missing when the interface is not "managed" by udev ++ # TODO(pstodulk): check the MAC, I think that that one should be ++ # actually always in DB. ++ attrs['driver'] = dev.get('ID_NET_DRIVER', '') ++ attrs['mac'] = dev.attributes.get('address', '') + if isinstance(attrs['mac'], bytes): + attrs['mac'] = attrs['mac'].decode() ++ ++ # pci info is not provided for cards that do not use PCI bus, ++ # also it can be missing if the interface is not "managed" by udev. ++ # Also vendor can be provided only for cards on PCI bus. ++ attrs['vendor'] = dev.get('ID_VENDOR_ID', '') ++ attrs['pci_info'] = None # default for non-PCI card ++ if dev.get('ID_PATH', '').startswith('pci-'): ++ attrs['pci_info'] = PCIAddress(**pci_info(dev['ID_PATH'])) + except Exception as e: # pylint: disable=broad-except + # FIXME(msekleta): We should probably handle errors more granularly + # Maybe we should inhibit upgrade process at this point +- api.current_logger().warning('Failed to gather information about network interface: %s', e) ++ net_name = attrs.get('name', 'unknown-interface') ++ api.current_logger().warning( ++ 'Failed to gather information about network interface %s: "%s"', ++ net_name, str(e) ++ ) ++ # NOTE(pstodulk): skipping the interface as it's really broken ++ # or unknown from the code in leapp-repository pov and another ++ # processing would lead now to a broken upgrades. ++ # Other values that are usually expected but can be missing ++ # in some situations are covered and do not raise this exception. + continue + ++ if not all([attrs['driver'], attrs['mac']]): ++ api.current_logger().warning( ++ 'Information in udev about %s network interface is incomplete.', ++ attrs['name'] ++ ) ++ + yield Interface(**attrs) +diff --git a/repos/system_upgrade/common/libraries/tests/test_persistentnetnames_library.py b/repos/system_upgrade/common/libraries/tests/test_persistentnetnames_library.py +index 74aa08fa..b45863d9 100644 +--- a/repos/system_upgrade/common/libraries/tests/test_persistentnetnames_library.py ++++ b/repos/system_upgrade/common/libraries/tests/test_persistentnetnames_library.py +@@ -1,57 +1,252 @@ ++import pytest ++ + from leapp.libraries.common import persistentnetnames + from leapp.libraries.common.testutils import produce_mocked + from leapp.libraries.stdlib import api ++from leapp.models import PCIAddress + + +-class AttributesTest: +- def __init__(self): +- self.attributes = { +- 'address': b'fa:16:3e:cd:26:5a' +- } ++class AttributesMocked: ++ def __init__(self, attributes): ++ self._attributes = attributes + +- def get(self, attribute): +- if attribute in self.attributes: +- return self.attributes[attribute] +- raise KeyError ++ def get(self, key, default=None): ++ return self._attributes.get(key, default) + + +-class DeviceTest: +- def __init__(self): +- self.dict_data = { +- 'ID_NET_DRIVER': 'virtio_net', +- 'ID_VENDOR_ID': '0x1af4', +- 'ID_PATH': 'pci-0000:00:03.0', +- } ++class DeviceMocked: ++ def __init__(self, properties, attributes): ++ self.dict_data = properties ++ self._attributes = attributes + + def __getitem__(self, key): ++ return self.dict_data[key] ++ ++ def get(self, key, default=None): + if key in self.dict_data: + return self.dict_data[key] +- raise KeyError ++ return default + + @property + def sys_name(self): +- return 'eth' ++ return self.dict_data['INTERFACE'] + + @property + def device_path(self): +- return '/devices/pci0000:00/0000:00:03.0/virtio0/net/eth0' ++ return self.dict_data['DEVPATH'] + + @property + def attributes(self): +- return AttributesTest() ++ return AttributesMocked(self._attributes) ++ + ++@pytest.mark.parametrize('input_mac', ('fa:16:3e:cd:26:5a', b'fa:16:3e:cd:26:5a')) ++def test_getting_interfaces_complete_good(monkeypatch, input_mac): ++ """ ++ Detailed parsing of physical net interface with complete data ++ """ ++ def mocked_physical_interfaces(): ++ properties = { ++ 'CURRENT_TAGS': ':systemd:', ++ 'DEVPATH': '/devices/pci0000:17/0000:17:02.0/0000:19:00.0/net/eno3', ++ 'ID_BUS': 'pci', ++ 'ID_MM_CANDIDATE': '1', ++ 'ID_MODEL_FROM_DATABASE': 'NetXtreme BCM5720 Gigabit Ethernet PCIe', ++ 'ID_MODEL_ID': '0x165f', ++ 'ID_NET_DRIVER': 'tg3', ++ 'ID_NET_LABEL_ONBOARD': 'NIC3', ++ 'ID_NET_LINK_FILE': '/usr/lib/systemd/network/99-default.link', ++ 'ID_NET_NAME': 'eno3', ++ 'ID_NET_NAME_MAC': 'enx34735a9920fe', ++ 'ID_NET_NAME_ONBOARD': 'eno3', ++ 'ID_NET_NAME_PATH': 'enp25s0f0', ++ 'ID_NET_NAMING_SCHEME': 'rhel-9.0', ++ 'ID_OUI_FROM_DATABASE': 'Dell Inc.', ++ 'ID_PATH': 'pci-0000:19:00.0', ++ 'ID_PATH_TAG': 'pci-0000_19_00_0', ++ 'ID_PCI_CLASS_FROM_DATABASE': 'Network controller', ++ 'ID_PCI_SUBCLASS_FROM_DATABASE': 'Ethernet controller', ++ 'ID_VENDOR_FROM_DATABASE': 'Broadcom Inc. and subsidiaries', ++ 'ID_VENDOR_ID': '0x14e4', ++ 'IFINDEX': '4', ++ 'INTERFACE': 'eno3', ++ 'SUBSYSTEM': 'net', ++ 'SYSTEMD_ALIAS': '/sys/subsystem/net/devices/eno3', ++ 'TAGS': ':systemd:', ++ 'USEC_INITIALIZED': '16690226' ++ } ++ attributes = { ++ 'address': input_mac ++ } ++ return [DeviceMocked(properties, attributes)] ++ ++ monkeypatch.setattr(persistentnetnames, 'physical_interfaces', mocked_physical_interfaces) ++ monkeypatch.setattr(api, 'produce', produce_mocked()) ++ ++ interface = next(persistentnetnames.interfaces()) + +-def provide_test_interfaces(): +- return [DeviceTest()] ++ assert interface.name == 'eno3' ++ assert interface.devpath == '/devices/pci0000:17/0000:17:02.0/0000:19:00.0/net/eno3' ++ assert interface.driver == 'tg3' ++ assert interface.vendor == '0x14e4' ++ assert interface.mac == 'fa:16:3e:cd:26:5a' ++ assert interface.pci_info == PCIAddress( ++ domain='0000', ++ bus='19', ++ device='00', ++ function='0' ++ ) + + +-def test_getting_interfaces(monkeypatch): +- monkeypatch.setattr(persistentnetnames, 'physical_interfaces', provide_test_interfaces) ++def test_getting_interfaces_complete_good_roce(monkeypatch): ++ """ ++ ROCE net interface parsing ++ """ ++ def mocked_physical_interfaces(): ++ properties = { ++ 'CURRENT_TAGS': ':systemd:', ++ 'DEVPATH': '/devices/pci0201:00/0201:00:00.0/net/eno513', ++ 'ID_BUS': 'pci', ++ 'ID_MODEL_FROM_DATABASE': 'ConnectX Family mlx5Gen Virtual Function', ++ 'ID_MODEL_ID': '0x101e', ++ 'ID_NET_DRIVER': 'mlx5_core', ++ 'ID_NET_LINK_FILE': '/etc/systemd/network/10-anaconda-ifname-eno513.link', ++ 'ID_NET_NAME': 'eno513', ++ 'ID_NET_NAME_MAC': 'enx2219aef66069', ++ 'ID_NET_NAME_ONBOARD': 'eno513', ++ 'ID_NET_NAME_PATH': 'enP513p0s0', ++ 'ID_NET_NAME_SLOT': 'ens5912', ++ 'ID_NET_NAMING_SCHEME': 'rhel-9.0', ++ 'ID_PATH': 'pci-0201:00:00.0', ++ 'ID_PATH_TAG': 'pci-0201_00_00_0', ++ 'ID_PCI_CLASS_FROM_DATABASE': 'Network controller', ++ 'ID_PCI_SUBCLASS_FROM_DATABASE': 'Ethernet controller', ++ 'ID_VENDOR_FROM_DATABASE': 'Mellanox Technologies', ++ 'ID_VENDOR_ID': '0x15b3', ++ 'IFINDEX': '2', ++ 'INTERFACE': 'eno513', ++ 'SUBSYSTEM': 'net', ++ 'SYSTEMD_ALIAS': '/sys/subsystem/net/devices/eno513', ++ 'TAGS': ':systemd:', ++ 'USEC_INITIALIZED': '26747014' ++ } ++ attributes = { ++ 'address': b'22:19:ae:f6:60:69' ++ } ++ ++ return [DeviceMocked(properties, attributes)] ++ ++ monkeypatch.setattr(persistentnetnames, 'physical_interfaces', mocked_physical_interfaces) + monkeypatch.setattr(api, 'produce', produce_mocked()) ++ + interface = next(persistentnetnames.interfaces()) ++ + assert interface.name + assert interface.devpath + assert interface.driver + assert interface.vendor ++ assert interface.mac + assert interface.pci_info ++ ++ ++@pytest.mark.parametrize(('properties', 'attributes'), ( ++ ( ++ { ++ # artificial data ++ 'CURRENT_TAGS': ':systemd:', ++ 'DEVPATH': '/devices/whatever/net/eno3', ++ 'ID_MM_CANDIDATE': '1', ++ 'ID_MODEL_FROM_DATABASE': 'Foo', ++ 'ID_MODEL_ID': '0x0000', ++ 'ID_NET_DRIVER': 'tg3', ++ 'ID_NET_LABEL_ONBOARD': 'NIC3', ++ 'ID_NET_LINK_FILE': '/usr/lib/systemd/network/99-default.link', ++ 'ID_NET_NAME': 'eno3', ++ 'ID_NET_NAME_MAC': 'enx34735a9920fe', ++ 'ID_NET_NAME_ONBOARD': 'eno3', ++ 'ID_NET_NAME_PATH': 'enp25s0f0', ++ 'ID_NET_NAMING_SCHEME': 'rhel-9.0', ++ 'ID_OUI_FROM_DATABASE': 'Dell Inc.', ++ 'IFINDEX': '4', ++ 'INTERFACE': 'eno3', ++ 'SUBSYSTEM': 'net', ++ 'SYSTEMD_ALIAS': '/sys/subsystem/net/devices/eno3', ++ 'TAGS': ':systemd:', ++ 'USEC_INITIALIZED': '16690226' ++ }, { ++ 'address': b'fa:16:3e:cd:26:5a' ++ } ++ ), ( ++ { ++ 'CURRENT_TAGS': ':systemd:', ++ 'DEVPATH': '/devices/css0/0.0.0001/0.0.0001/virtio1/net/enc1', ++ 'ID_NET_DRIVER': 'virtio_net', ++ 'ID_NET_LINK_FILE': '/usr/lib/systemd/network/99-default.link', ++ 'ID_NET_NAME': 'enc1', ++ 'ID_NET_NAME_MAC': 'enx001738010124', ++ 'ID_NET_NAME_PATH': 'enc1', ++ 'ID_NET_NAMING_SCHEME': 'rhel-9.0', ++ 'ID_OUI_FROM_DATABASE': 'International Business Machines', ++ 'ID_PATH': 'ccw-0.0.0001', ++ 'ID_PATH_TAG': 'ccw-0_0_0001', ++ 'IFINDEX': '2', ++ 'INTERFACE': 'enc1', ++ 'SUBSYSTEM': 'net', ++ 'SYSTEMD_ALIAS': '/sys/subsystem/net/devices/enc1', ++ 'TAGS': ':systemd:', ++ 'USEC_INITIALIZED': '3423981' ++ }, { ++ 'address': b'00:17:38:01:01:24' ++ } ++ ) ++)) ++def test_getting_interfaces_nonpci_good(monkeypatch, properties, attributes): ++ """ ++ Processing of net interface with incomplete data ++ """ ++ def mocked_physical_interfaces(): ++ return [DeviceMocked(properties, attributes)] ++ ++ monkeypatch.setattr(persistentnetnames, 'physical_interfaces', mocked_physical_interfaces) ++ monkeypatch.setattr(api, 'produce', produce_mocked()) ++ ++ interface = next(persistentnetnames.interfaces()) ++ ++ assert interface.name ++ assert interface.devpath ++ assert interface.driver ++ assert not interface.vendor ++ assert interface.mac ++ assert not interface.pci_info ++ ++ ++def test_getting_interfaces_incomplete_udev_conflict(monkeypatch): ++ """ ++ Test parsing of conflicting interface. ++ ++ Such interface is not managed by udev and the information we could get ++ about it is limited. ++ """ ++ def mocked_physical_interfaces(): ++ properties = { ++ 'DEVPATH': '/devices/pci0000:ae/0000:ae:00.0/0000:af:00.0/0000:b0:04.0/0000:b2:00.1/net/eth3', ++ 'IFINDEX': '9', ++ 'INTERFACE': 'eth3', ++ 'SUBSYSTEM': 'net' ++ } ++ attributes = { ++ 'address': b'fa:16:3e:cd:26:5a' ++ } ++ return [DeviceMocked(properties, attributes)] ++ ++ monkeypatch.setattr(persistentnetnames, 'physical_interfaces', mocked_physical_interfaces) ++ monkeypatch.setattr(api, 'produce', produce_mocked()) ++ ++ interface = next(persistentnetnames.interfaces()) ++ ++ assert interface.name ++ assert interface.devpath ++ assert not interface.driver ++ assert not interface.vendor + assert interface.mac ++ assert not interface.pci_info +diff --git a/repos/system_upgrade/common/models/persistentnetnamesfacts.py b/repos/system_upgrade/common/models/persistentnetnamesfacts.py +index 395b26f0..3c71cdcd 100644 +--- a/repos/system_upgrade/common/models/persistentnetnamesfacts.py ++++ b/repos/system_upgrade/common/models/persistentnetnamesfacts.py +@@ -4,7 +4,10 @@ from leapp.topics import SystemInfoTopic + + class PCIAddress(Model): + """ +- TODO: tbd ++ Network Interface PCI address. ++ ++ This model should not be produced nor consumed by actors directly. ++ It's part of the Interface model. + """ + topic = SystemInfoTopic + +@@ -16,16 +19,49 @@ class PCIAddress(Model): + + class Interface(Model): + """ +- TODO: tbd - Interface or NetworkInterface? ++ Physical network interface ++ ++ Contains information about a network interface collected from udev. ++ Data can be incomplete in case of issues or when the interface is not ++ managed by udev. ++ ++ This model should not be produced or consumed by actors directly. ++ See PersistentNetNamesFacts or PersistentNetNamesFactsInitramfs. + """ + topic = SystemInfoTopic + + name = fields.String() ++ """ ++ Name of the interface. ++ """ ++ + devpath = fields.String() ++ """ ++ Path to the device. ++ """ ++ + driver = fields.String() ++ """ ++ Network interface driver identifier. ++ """ ++ + vendor = fields.String() +- pci_info = fields.Model(PCIAddress) ++ """ ++ Numeric identifier of the hardware vendor on PCI bus. ++ """ ++ ++ pci_info = fields.Nullable(fields.Model(PCIAddress)) ++ """ ++ Parsed PCI address of the network interface. ++ ++ The value is None if the network interface is not connected via PCI or it is not managed ++ by udev. ++ """ ++ + mac = fields.String() ++ """ ++ MAC address of the network interface. ++ """ + + + class PersistentNetNamesFacts(Model): +@@ -34,6 +70,9 @@ class PersistentNetNamesFacts(Model): + """ + topic = SystemInfoTopic + interfaces = fields.List(fields.Model(Interface)) ++ """ ++ List of network interfaces with information collected from udev. ++ """ + + + class PersistentNetNamesFactsInitramfs(PersistentNetNamesFacts): +@@ -49,8 +88,17 @@ class RenamedInterface(Model): + """ + topic = SystemInfoTopic + ++ # TODO(pstodulk) deprecate these fields and replace them by new ones ++ # or deprecate the model completely. + rhel7_name = fields.String() ++ """ ++ Original interface name. ++ """ ++ + rhel8_name = fields.String() ++ """ ++ New interface name. ++ """ + + + class RenamedInterfaces(Model): +@@ -63,3 +111,6 @@ class RenamedInterfaces(Model): + topic = SystemInfoTopic + + renamed = fields.List(fields.Model(RenamedInterface)) ++ """ ++ The list of renamed interfaces. ++ """ +-- +2.53.0 + diff --git a/0031-persistentnetnamesconfig-Deprecate-legacy-functional.patch b/0031-persistentnetnamesconfig-Deprecate-legacy-functional.patch new file mode 100644 index 0000000..68ff880 --- /dev/null +++ b/0031-persistentnetnamesconfig-Deprecate-legacy-functional.patch @@ -0,0 +1,398 @@ +From c60f657713f130d3accee7ceb303d7286b6180d5 Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Wed, 18 Mar 2026 17:57:56 +0100 +Subject: [PATCH 31/44] persistentnetnamesconfig: Deprecate legacy + functionality + +The legacy solution to make NIC names persistent during the upgrade +is buggy and usually it's not used nowadays. Creation of link files +in the legacy solution breaks bonding configuration and also does not +handle interfaces in case of InfiniBand and RDMA. + +At this point, we plan to use of net naming scheme mandatory during +the upgrade (or at least the only solution for persistent NIC names). +Mark following symbols as deprecated: + * LEAPP_DISABLE_NET_NAMING_SCHEMES (envar) + * LEAPP_NO_NETWORK_RENAMING (envar) + * RenamedInterfaces (model) + * RenamedInterface (model) + +Also the RenamedInterface model had fields `rhel7_name` & `rhel8_name`, +which has not actually correspond to the real state. So the fields +have been renamed instantly to `original_name` & `new_name`. + +Also dropping the produce of InitrdInclude message in the actor as +the model is deprecated for a long time. + +We could possibly still think about reporting changed interface names, +but such a report should happen in the last (FirstBoot) phase when +the networking should be already fully initialized. Such a report +would be just a check whether net naming scheme works as expected. +But it's not considered at this very moment. +--- + docs/source/configuring-ipu/envars.md | 20 +++++++- + .../libraries-and-api/deprecations-list.md | 6 ++- + .../actors/persistentnetnamesconfig/actor.py | 19 ++++--- + .../libraries/persistentnetnamesconfig.py | 27 +++++----- + .../tests/test_persistentnetnamesconfig.py | 50 ++++++++++--------- + .../common/models/persistentnetnamesfacts.py | 21 ++++++-- + 6 files changed, 93 insertions(+), 50 deletions(-) + +diff --git a/docs/source/configuring-ipu/envars.md b/docs/source/configuring-ipu/envars.md +index 72d00634..9fa37f4f 100644 +--- a/docs/source/configuring-ipu/envars.md ++++ b/docs/source/configuring-ipu/envars.md +@@ -6,11 +6,21 @@ Below is a list of the general and development variables available. + ### General variables + + #### LEAPP_DISABLE_NET_NAMING_SCHEMES +-On RHEL 8 to 9 upgrades, by default, net.naming-scheme is used to make network interface names immutable during the upgrade. In this case an extra RPM named `rhel-net-naming-sysattrs` is installed to the target system and target userspace container, providing the definitions of the "profiles" for net.naming-scheme. ++The `net.naming-scheme` kernel command line option is used by default to make ++network interface names immutable during the upgrade. ++In this case an extra RPM named `rhel-net-naming-sysattrs` (or `net-naming-sysattrs`) ++is installed to the target system and target userspace container, providing ++the definitions of the "profiles" for `net.naming-scheme`. + +-If set to `0`, the "legacy" mechanism is used where leapp writes .link files to prevent interfaces being renamed ++If set to `0`, the legacy mechanism is used where leapp writes .link files to prevent interfaces being renamed + after booting to post-upgrade system. + ++```{warning} ++The variable is deprecated as it is a part of the legacy solution for handling ++NIC names during the upgrade. Current supported solution allows only using ++the `net.naming-scheme`. ++``` ++ + #### LEAPP_ENABLE_REPOS + Specify repositories (repoids) split by comma, that should be used during the in-place upgrade to the target system. It‘s overwritten automatically in case the --enablerepo option is used. It‘s recommended to use the --enablerepo option instead of the envar. + +@@ -26,6 +36,12 @@ If set to `1`, Leapp does not register the system into Red Hat Lightspeed automa + #### LEAPP_NO_NETWORK_RENAMING + If set to `1`, the actor responsible to handle NICs names ends without doing anything. The actor usually creates UDEV rules to preserve original NICs in case they are changed. However, in some cases it‘s not wanted and it leads in malfunction network configuration (e.g. in case the bonding is configured on the system). It‘s expected that NICs have to be handled manually if needed. + ++```{warning} ++The variable is deprecated as it is a part of the legacy solution for ++handling NIC names during the upgrade. Current supported solution allows only ++using of the `net.naming-scheme`. ++``` ++ + ##### LEAPP_NO_RHSM + If set to `1`, Leapp does not use Red Hat Subscription Management for the upgrade. It‘s equivalent to the --no-rhsm leapp option. + +diff --git a/docs/source/libraries-and-api/deprecations-list.md b/docs/source/libraries-and-api/deprecations-list.md +index 679bf489..a074ebc1 100644 +--- a/docs/source/libraries-and-api/deprecations-list.md ++++ b/docs/source/libraries-and-api/deprecations-list.md +@@ -13,7 +13,11 @@ framework, see {ref}`deprecation:list of the deprecated functionality in leapp`. + Only the versions in which a deprecation has been made are listed. + + ## Next release (till TODO date) +-- Note: nothing new deprecated yet ++- Environment variables ++ - **`LEAPP_DISABLE_NET_NAMING_SCHEMES`** - The `net.naming-scheme` kernel argument provides much better alternative to the legacy solution enabled using this variable. Hence the legacy solution is deprecated together with this environment variable. ++ - **`LEAPP_NO_NETWORK_RENAMING`** - It becomes obsoleted by the solution based on `net.naming-scheme` which replaces the legacy solution based on created udev link files correcting NIC names during the upgrade. ++- Models: ++ - **`RenamedInterfaces`** - Information provided in this message is not always complete and it's not used since the `net.naming-scheme` kernel command line argument is set during the upgrade. + + ## v0.24.0 (till September 2026) + - Shared libraries +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesconfig/actor.py b/repos/system_upgrade/common/actors/persistentnetnamesconfig/actor.py +index 2689d837..7a21b43a 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesconfig/actor.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesconfig/actor.py +@@ -1,7 +1,6 @@ + from leapp.actors import Actor + from leapp.libraries.actor import persistentnetnamesconfig + from leapp.models import ( +- InitrdIncludes, + PersistentNetNamesFacts, + PersistentNetNamesFactsInitramfs, + RenamedInterfaces, +@@ -11,21 +10,27 @@ from leapp.tags import ApplicationsPhaseTag, IPUWorkflowTag + from leapp.utils.deprecation import suppress_deprecation + + +-@suppress_deprecation(InitrdIncludes) ++@suppress_deprecation(RenamedInterfaces) + class PersistentNetNamesConfig(Actor): + """ + Generate udev persistent network naming configuration + +- This actor generates systemd-udevd link files for each physical ethernet interface present on RHEL-7 +- in case we notice that interface name differs on RHEL-8. Link file configuration will assign RHEL-7 version of +- a name. Actors produces list of interfaces which changed name between RHEL-7 and RHEL-8. ++ NOTE: This actor is deprecated and currently performs described actions ++ only if LEAPP_NO_NETWORK_RENAMING != 1 and LEAPP_DISABLE_NET_NAMING_SCHEMES == 1. ++ ++ This actor generates systemd-udevd link files for each physical network ++ interface present on the original system if the interface name differs ++ on the target OS. Link file configuration will assign original name that has ++ been detected on the source OS. ++ ++ Also produce list of interfaces which changed names during the upgrade ++ process. + """ + + name = 'persistentnetnamesconfig' + consumes = (PersistentNetNamesFacts, PersistentNetNamesFactsInitramfs) +- produces = (RenamedInterfaces, InitrdIncludes, TargetInitramfsTasks) ++ produces = (RenamedInterfaces, TargetInitramfsTasks) + tags = (ApplicationsPhaseTag, IPUWorkflowTag) +- initrd_files = [] + + def process(self): + persistentnetnamesconfig.process() +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesconfig/libraries/persistentnetnamesconfig.py b/repos/system_upgrade/common/actors/persistentnetnamesconfig/libraries/persistentnetnamesconfig.py +index 189cd4d0..0618f090 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesconfig/libraries/persistentnetnamesconfig.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesconfig/libraries/persistentnetnamesconfig.py +@@ -2,10 +2,9 @@ import errno + import os + import re + +-from leapp.libraries.common.config import get_env, version ++from leapp.libraries.common.config import get_env + from leapp.libraries.stdlib import api + from leapp.models import ( +- InitrdIncludes, + PersistentNetNamesFacts, + PersistentNetNamesFactsInitramfs, + RenamedInterface, +@@ -37,18 +36,21 @@ def generate_link_file(interface): + return link_file + + +-@suppress_deprecation(InitrdIncludes) ++@suppress_deprecation(RenamedInterfaces, RenamedInterface) + def process(): + are_net_schemes_enabled = get_env('LEAPP_DISABLE_NET_NAMING_SCHEMES', '0') != '1' +- is_upgrade_8to9 = version.get_target_major_version() == '9' + +- if are_net_schemes_enabled and is_upgrade_8to9: +- # For 8>9 we are using net.naming_scheme kernel arg by default - do not generate link files ++ if are_net_schemes_enabled: + msg = ('Skipping generation of .link files renaming NICs as net.naming-scheme ' +- '{LEAPP_DISABLE_NET_NAMING_SCHEMES != 1} is enabled and upgrade is 8>9') +- api.current_logger().info(msg) ++ '{LEAPP_DISABLE_NET_NAMING_SCHEMES != 1} is enabled.') ++ api.current_logger().debug(msg) + return + ++ api.current_logger().warning( ++ 'LEAPP_DISABLE_NET_NAMING_SCHEMES=1 - Using deprecated handling' ++ ' of network interface names by creating link files.' ++ ) ++ + if get_env('LEAPP_NO_NETWORK_RENAMING', '0') == '1': + api.current_logger().info( + 'Skipping handling of possibly renamed network interfaces: leapp executed with LEAPP_NO_NETWORK_RENAMING=1' +@@ -80,13 +82,13 @@ def process(): + ) + continue + +- if source_name != target_name and get_env('LEAPP_NO_NETWORK_RENAMING', '0') != '1': ++ if source_name != target_name: + api.current_logger().warning('Detected interface rename {} -> {}.'.format(source_name, target_name)) + +- if re.search('eth[0-9]+', iface.name) is not None: ++ if re.search('^eth[0-9]+$', iface.name) is not None: + api.current_logger().warning('Interface named using eth prefix, refusing to generate link file') +- renamed_interfaces.append(RenamedInterface(**{'rhel7_name': source_name, +- 'rhel8_name': target_name})) ++ renamed_interfaces.append(RenamedInterface(**{'original_name': source_name, ++ 'new_name': target_name})) + continue + + initrd_files.append(generate_link_file(iface)) +@@ -108,7 +110,6 @@ def process(): + api.current_logger().warning(msg) + + api.produce(RenamedInterfaces(renamed=renamed_interfaces)) +- api.produce(InitrdIncludes(files=initrd_files)) + # TODO: cover actor by tests in future. I am skipping writing of tests + # now as some refactoring and bugfixing related to this actor + # is planned already. +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py b/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py +index c584c7ea..b107612b 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py +@@ -7,7 +7,8 @@ from leapp.libraries.actor import persistentnetnamesconfig + from leapp.libraries.common.config import mock_configs + from leapp.libraries.common.testutils import CurrentActorMocked, logger_mocked, produce_mocked + from leapp.models import ( +- InitrdIncludes, ++ EnvVar, ++ IPUConfig, + Interface, + PCIAddress, + PersistentNetNamesFacts, +@@ -19,6 +20,19 @@ from leapp.models import ( + TEST_DIR = os.path.dirname(os.path.abspath(__file__)) + CUR_DIR = "" + ++CONFIG_DISABLED_NAMING_SCHEMES = IPUConfig( ++ leapp_env_vars=[ ++ EnvVar(name='LEAPP_DEVEL', value='0'), ++ EnvVar(name='LEAPP_DISABLE_NET_NAMING_SCHEMES', value='1'), ++ ], ++ os_release=mock_configs.CONFIG.os_release, ++ version=mock_configs.CONFIG.version, ++ architecture=mock_configs.CONFIG.architecture, ++ kernel=mock_configs.CONFIG.kernel, ++ supported_upgrade_paths=mock_configs.CONFIG.supported_upgrade_paths, ++ distro=mock_configs.CONFIG.distro ++) ++ + + @pytest.fixture + def adjust_cwd(): +@@ -56,12 +70,10 @@ def test_identical(current_actor_context): + interfaces = generate_interfaces(4) + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interfaces)) + current_actor_context.feed(PersistentNetNamesFactsInitramfs(interfaces=interfaces)) +- current_actor_context.run(config_model=mock_configs.CONFIG) ++ current_actor_context.run(config_model=CONFIG_DISABLED_NAMING_SCHEMES) + + renamed_interfaces = current_actor_context.consume(RenamedInterfaces)[0] +- initrd_files = current_actor_context.consume(InitrdIncludes)[0] + t_initrafms_tasks = current_actor_context.consume(TargetInitramfsTasks)[0] +- assert initrd_files.files == t_initrafms_tasks.include_files + assert not renamed_interfaces.renamed + assert not t_initrafms_tasks.include_files + +@@ -73,12 +85,10 @@ def test_renamed_single_noneth(monkeypatch, current_actor_context): + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interfaces)) + interfaces[0].name = 'n4' + current_actor_context.feed(PersistentNetNamesFactsInitramfs(interfaces=interfaces)) +- current_actor_context.run(config_model=mock_configs.CONFIG) ++ current_actor_context.run(config_model=CONFIG_DISABLED_NAMING_SCHEMES) + + renamed_interfaces = current_actor_context.consume(RenamedInterfaces)[0] +- initrd_files = current_actor_context.consume(InitrdIncludes)[0] + t_initrafms_tasks = current_actor_context.consume(TargetInitramfsTasks)[0] +- assert initrd_files.files == t_initrafms_tasks.include_files + assert not renamed_interfaces.renamed + assert len(t_initrafms_tasks.include_files) == 1 + assert '/etc/systemd/network/10-leapp-n0.link' in t_initrafms_tasks.include_files +@@ -92,12 +102,10 @@ def test_renamed_swap_noneth(monkeypatch, current_actor_context): + interfaces[0].name = 'n3' + interfaces[3].name = 'n0' + current_actor_context.feed(PersistentNetNamesFactsInitramfs(interfaces=interfaces)) +- current_actor_context.run(config_model=mock_configs.CONFIG) ++ current_actor_context.run(config_model=CONFIG_DISABLED_NAMING_SCHEMES) + + renamed_interfaces = current_actor_context.consume(RenamedInterfaces)[0] +- initrd_files = current_actor_context.consume(InitrdIncludes)[0] + t_initrafms_tasks = current_actor_context.consume(TargetInitramfsTasks)[0] +- assert initrd_files.files == t_initrafms_tasks.include_files + assert not renamed_interfaces.renamed + assert len(t_initrafms_tasks.include_files) == 2 + assert '/etc/systemd/network/10-leapp-n0.link' in t_initrafms_tasks.include_files +@@ -113,15 +121,13 @@ def test_renamed_single_eth(monkeypatch, current_actor_context): + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interfaces)) + interfaces[0].name = 'eth4' + current_actor_context.feed(PersistentNetNamesFactsInitramfs(interfaces=interfaces)) +- current_actor_context.run(config_model=mock_configs.CONFIG) ++ current_actor_context.run(config_model=CONFIG_DISABLED_NAMING_SCHEMES) + + renamed_interfaces = current_actor_context.consume(RenamedInterfaces)[0] +- initrd_files = current_actor_context.consume(InitrdIncludes)[0] + t_initrafms_tasks = current_actor_context.consume(TargetInitramfsTasks)[0] +- assert initrd_files.files == t_initrafms_tasks.include_files + assert len(renamed_interfaces.renamed) == 1 +- assert renamed_interfaces.renamed[0].rhel7_name == 'eth0' +- assert renamed_interfaces.renamed[0].rhel8_name == 'eth4' ++ assert renamed_interfaces.renamed[0].original_name == 'eth0' ++ assert renamed_interfaces.renamed[0].new_name == 'eth4' + assert not t_initrafms_tasks.include_files + + +@@ -135,18 +141,16 @@ def test_renamed_swap_eth(monkeypatch, current_actor_context): + interfaces[0].name = 'eth3' + interfaces[3].name = 'eth0' + current_actor_context.feed(PersistentNetNamesFactsInitramfs(interfaces=interfaces)) +- current_actor_context.run(config_model=mock_configs.CONFIG) ++ current_actor_context.run(config_model=CONFIG_DISABLED_NAMING_SCHEMES) + + renamed_interfaces = current_actor_context.consume(RenamedInterfaces)[0] +- initrd_files = current_actor_context.consume(InitrdIncludes)[0] + t_initrafms_tasks = current_actor_context.consume(TargetInitramfsTasks)[0] +- assert initrd_files.files == t_initrafms_tasks.include_files + assert len(renamed_interfaces.renamed) == 2 + for interface in renamed_interfaces.renamed: +- if interface.rhel7_name == 'eth0': +- assert interface.rhel8_name == 'eth3' +- elif interface.rhel7_name == 'eth3': +- assert interface.rhel8_name == 'eth0' ++ if interface.original_name == 'eth0': ++ assert interface.new_name == 'eth3' ++ elif interface.original_name == 'eth3': ++ assert interface.new_name == 'eth0' + assert not t_initrafms_tasks.include_files + + +@@ -179,7 +183,7 @@ def test_bz_1899455_crash_iface(monkeypatch, adjust_cwd): + monkeypatch.setattr(persistentnetnamesconfig.api, 'produce', produce_mocked()) + persistentnetnamesconfig.process() + +- for prod_models in [RenamedInterfaces, InitrdIncludes, TargetInitramfsTasks]: ++ for prod_models in [RenamedInterfaces, TargetInitramfsTasks]: + any(isinstance(i, prod_models) for i in persistentnetnamesconfig.api.produce.model_instances) + assert any('Some network devices' in x for x in persistentnetnamesconfig.api.current_logger.warnmsg) + +diff --git a/repos/system_upgrade/common/models/persistentnetnamesfacts.py b/repos/system_upgrade/common/models/persistentnetnamesfacts.py +index 3c71cdcd..e5cf979b 100644 +--- a/repos/system_upgrade/common/models/persistentnetnamesfacts.py ++++ b/repos/system_upgrade/common/models/persistentnetnamesfacts.py +@@ -1,5 +1,6 @@ + from leapp.models import fields, Model + from leapp.topics import SystemInfoTopic ++from leapp.utils.deprecation import deprecated + + + class PCIAddress(Model): +@@ -82,25 +83,37 @@ class PersistentNetNamesFactsInitramfs(PersistentNetNamesFacts): + pass + + ++@deprecated( ++ since="2026-03-18", ++ message=( ++ "Information provided in this message is not always complete and it's" ++ " not used nowadays when net naming scheme is set during the upgrade." ++ ) ++) + class RenamedInterface(Model): + """ + Provide original and new name of the network interface when renamed + """ + topic = SystemInfoTopic + +- # TODO(pstodulk) deprecate these fields and replace them by new ones +- # or deprecate the model completely. +- rhel7_name = fields.String() ++ original_name = fields.String() + """ + Original interface name. + """ + +- rhel8_name = fields.String() ++ new_name = fields.String() + """ + New interface name. + """ + + ++@deprecated( ++ since="2026-03-18", ++ message=( ++ "Information provided in this message is not always complete and it's" ++ " not used nowadays when net naming scheme is set during the upgrade." ++ ) ++) + class RenamedInterfaces(Model): + """ + Provide list of renamed network interfaces +-- +2.53.0 + diff --git a/0032-persistentnetnamesdisable-Disable-net.ifnames-correc.patch b/0032-persistentnetnamesdisable-Disable-net.ifnames-correc.patch new file mode 100644 index 0000000..a857396 --- /dev/null +++ b/0032-persistentnetnamesdisable-Disable-net.ifnames-correc.patch @@ -0,0 +1,124 @@ +From 0872576049715c7a909379d5de5cc53bab3a408a Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Fri, 20 Mar 2026 17:19:20 +0100 +Subject: [PATCH 32/44] persistentnetnamesdisable: Disable net.ifnames + correctly for single eth + +Original solution disabled net.ifnames only for the target kernel +bootloader entry. But the upgrade initramfs stayed unhandled. +So it could happen that a "false positive" detection of changed +network interface names could been detected during the upgrade process +even when the target system booted again with "eth0" net interface +(because of net.ifnames=0). Set the parameter also for the upgrade +environment to behave same as on the target system. + +Also, actor originally produced just the KernelCmdlineArg msg, +which is nowadays considered kind of obsoleted for this purpose +- still valid, but obsoleted. So produce UpgradeKernelCmdlineArgTasks +and TargetKernelCmdlineArgTasks msgs instead. +--- + .../tests/test_persistentnetnamesconfig.py | 2 +- + .../common/actors/persistentnetnamesdisable/actor.py | 8 ++++++-- + .../libraries/persistentnetnamesdisable.py | 11 +++++++++-- + .../tests/test_persistentnetnamesdisable.py | 10 +++++++++- + 4 files changed, 25 insertions(+), 6 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py b/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py +index b107612b..f2519d77 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesconfig/tests/test_persistentnetnamesconfig.py +@@ -8,8 +8,8 @@ from leapp.libraries.common.config import mock_configs + from leapp.libraries.common.testutils import CurrentActorMocked, logger_mocked, produce_mocked + from leapp.models import ( + EnvVar, +- IPUConfig, + Interface, ++ IPUConfig, + PCIAddress, + PersistentNetNamesFacts, + PersistentNetNamesFactsInitramfs, +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +index 15c43141..741e2c86 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +@@ -1,6 +1,10 @@ + from leapp.actors import Actor + from leapp.libraries.actor import persistentnetnamesdisable +-from leapp.models import KernelCmdlineArg, PersistentNetNamesFacts ++from leapp.models import ( ++ PersistentNetNamesFacts, ++ TargetKernelCmdlineArgTasks, ++ UpgradeKernelCmdlineArgTasks ++) + from leapp.reporting import Report + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + +@@ -12,7 +16,7 @@ class PersistentNetNamesDisable(Actor): + + name = 'persistentnetnamesdisable' + consumes = (PersistentNetNamesFacts,) +- produces = (KernelCmdlineArg, Report) ++ produces = (Report, TargetKernelCmdlineArgTasks, UpgradeKernelCmdlineArgTasks) + tags = (ChecksPhaseTag, IPUWorkflowTag) + + def process(self): +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +index 0d1a90e2..38eef133 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +@@ -3,7 +3,12 @@ import re + from leapp import reporting + from leapp.libraries.common.config.version import get_target_major_version + from leapp.libraries.stdlib import api +-from leapp.models import KernelCmdlineArg, PersistentNetNamesFacts ++from leapp.models import ( ++ KernelCmdlineArg, ++ PersistentNetNamesFacts, ++ TargetKernelCmdlineArgTasks, ++ UpgradeKernelCmdlineArgTasks ++) + from leapp.reporting import create_report + + +@@ -29,7 +34,9 @@ def disable_persistent_naming(): + "Single eth0 network interface detected." + " Appending 'net.ifnames=0' for the target system kernel commandline" + ) +- api.produce(KernelCmdlineArg(**{'key': 'net.ifnames', 'value': '0'})) ++ k_arg = KernelCmdlineArg(key='net.ifnames', value='0') ++ api.produce(UpgradeKernelCmdlineArgTasks(to_add=[k_arg])) ++ api.produce(TargetKernelCmdlineArgTasks(to_add=[k_arg])) + + + def report_ethX_ifaces(): +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +index 2369e80f..81b5a28c 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +@@ -1,7 +1,13 @@ + import pytest + + from leapp.libraries.actor import persistentnetnamesdisable +-from leapp.models import Interface, KernelCmdlineArg, PCIAddress, PersistentNetNamesFacts ++from leapp.models import ( ++ Interface, ++ PCIAddress, ++ PersistentNetNamesFacts, ++ TargetKernelCmdlineArgTasks, ++ UpgradeKernelCmdlineArgTasks ++) + from leapp.reporting import Report + from leapp.snactor.fixture import current_actor_context + from leapp.utils.report import is_inhibitor +@@ -51,6 +57,8 @@ def test_actor_single_eth0(current_actor_context): + current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) + current_actor_context.run() + assert not current_actor_context.consume(Report) ++ assert current_actor_context.consume(UpgradeKernelCmdlineArgTasks) ++ assert current_actor_context.consume(TargetKernelCmdlineArgTasks) + + + @pytest.mark.parametrize( +-- +2.53.0 + diff --git a/0033-persistentnetnamesdisable-Mention-net.naming-scheme-.patch b/0033-persistentnetnamesdisable-Mention-net.naming-scheme-.patch new file mode 100644 index 0000000..792a1fe --- /dev/null +++ b/0033-persistentnetnamesdisable-Mention-net.naming-scheme-.patch @@ -0,0 +1,303 @@ +From 806e65d67cac9e16c0341f366133ae3c14844fcd Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Wed, 25 Mar 2026 15:57:37 +0100 +Subject: [PATCH 33/44] persistentnetnamesdisable: Mention net.naming-scheme in + report + +Since RHEL 8 it's possible to specifcy net.naming-scheme to have +a consistent NIC names across RHEL major releases. When a specific +net.naming-scheme is not specified in kernel cmdline, suggest people +this option as well. +--- + .../actors/persistentnetnamesdisable/actor.py | 15 +++- + .../libraries/persistentnetnamesdisable.py | 86 +++++++++++++++---- + .../tests/test_persistentnetnamesdisable.py | 78 ++++++++++++++++- + 3 files changed, 158 insertions(+), 21 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +index 741e2c86..0bcc3827 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/actor.py +@@ -1,6 +1,7 @@ + from leapp.actors import Actor + from leapp.libraries.actor import persistentnetnamesdisable + from leapp.models import ( ++ KernelCmdline, + PersistentNetNamesFacts, + TargetKernelCmdlineArgTasks, + UpgradeKernelCmdlineArgTasks +@@ -11,11 +12,21 @@ from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + + class PersistentNetNamesDisable(Actor): + """ +- Disable systemd-udevd persistent network naming on machine with single eth0 NIC ++ Check whether the system has any (physical) NICs with kernel naming (ethX) ++ ++ The kernel naming is in general unstable - there is no guarantee of persistent ++ NIC names between reboots, so eth0 can becaome eth3 and vice versa. If the ++ system has more than one physical network interface, the kernel naming must ++ not be used otherwise the upgrade is inhibited. The report contains remediation ++ hints for user to resolve the problem before the upgrade. ++ ++ On systems with only one physical network interface with eth0 NIC, register ++ task to disable systemd-udevd persistent network naming (set `net.ifnames=0` ++ on kernel cmdline for the upgrade environment and the upgraded system. + """ + + name = 'persistentnetnamesdisable' +- consumes = (PersistentNetNamesFacts,) ++ consumes = (PersistentNetNamesFacts, KernelCmdline) + produces = (Report, TargetKernelCmdlineArgTasks, UpgradeKernelCmdlineArgTasks) + tags = (ChecksPhaseTag, IPUWorkflowTag) + +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +index 38eef133..0a4209b8 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/libraries/persistentnetnamesdisable.py +@@ -1,9 +1,11 @@ + import re + + from leapp import reporting +-from leapp.libraries.common.config.version import get_target_major_version ++from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.common.config.version import get_source_major_version, get_target_major_version + from leapp.libraries.stdlib import api + from leapp.models import ( ++ KernelCmdline, + KernelCmdlineArg, + PersistentNetNamesFacts, + TargetKernelCmdlineArgTasks, +@@ -29,6 +31,40 @@ def single_eth0(interfaces): + return len(interfaces) == 1 and interfaces[0].name == 'eth0' + + ++def is_kernel_arg_present(key, value=None): ++ """ ++ Return True if requested argument is set in kernel cmdline. Return False otherwise. ++ ++ If the `value` is specified, check also whether the specific value is set. ++ The function consumes :class:`KernelCmdline`. ++ ++ :param key: The kernel argument to search for ++ :type key: str ++ :param value: If string is specified, check for a specific string as well. ++ :type value: str|None ++ :rtype: bool ++ """ ++ # NOTE(pstodulk): with small update a possible candidate to move into the ++ # kernel shared library. For now, keeping it just in this actor. ++ k_cmdline = next(api.consume(KernelCmdline), None) ++ if not k_cmdline: ++ # NOTE(pstodulk): this hypothetical situation, skipping coverage by ++ # unit tests ++ raise StopActorExecutionError( ++ message='Missing information about current kernel command line.', ++ details={ ++ 'details': 'Missing the KernelCmdline message.' ++ } ++ ) ++ ++ for k_arg in k_cmdline.parameters: ++ if k_arg.key != key: ++ continue ++ if value is None or k_arg.value == value: ++ return True ++ return False ++ ++ + def disable_persistent_naming(): + api.current_logger().info( + "Single eth0 network interface detected." +@@ -40,27 +76,30 @@ def disable_persistent_naming(): + + + def report_ethX_ifaces(): +- report_entries = [ +- reporting.Title('Unsupported network configuration'), +- reporting.Summary( +- 'Detected multiple physical network interfaces where one or more' +- ' use kernel naming (e.g. eth0). Upgrade process cannot continue' +- ' because stability of names can not be guaranteed.' +- ), ++ url_title_kb = 'How to Perform an In-Place Upgrade when Using Kernel-Assigned NIC Names' ++ hint_text = f'Rename all ethX network interfaces following the "{url_title_kb}" solution article.' ++ report_external_links = [ + reporting.ExternalLink( +- title='How to Perform an In-Place Upgrade when Using Kernel-Assigned NIC Names', ++ title=url_title_kb, + url='https://access.redhat.com/solutions/4067471' +- ), +- reporting.Remediation( +- hint='Rename all ethX network interfaces following the attached KB solution article.' +- ), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.NETWORK]), +- reporting.Groups([reporting.Groups.INHIBITOR]) ++ ) + ] ++ if not is_kernel_arg_present('net.naming-scheme') and not is_kernel_arg_present('net.ifnames', '0'): ++ hint_text += ( ++ ' If the detected ethX interfaces are not manually configured, it is' ++ ' possible that new names were not assigned due to a naming conflict' ++ ' in the current `net.naming-scheme`. This can be resolved by' ++ ' configuring a newer naming scheme via the kernel argument.' ++ ' For more information, see "Implementing consistent network interface naming".' ++ ) + ++ # NOTE(pstodulk): the link is covered for RHEL 8, 9, 10 ++ report_external_links.append(reporting.ExternalLink( ++ title='Implementing consistent network interface naming', ++ url='https://red.ht/rhel-{}-consistent-nic-naming'.format(get_source_major_version()) ++ )) + if get_target_major_version() == '9': +- report_entries.append( ++ report_external_links.append( + reporting.ExternalLink( + title='RHEL 8 to RHEL 9: inplace upgrade fails at ' + '"Network configuration for unsupported device types detected"', +@@ -68,6 +107,19 @@ def report_ethX_ifaces(): + ) + ) + ++ report_entries = [ ++ reporting.Title('Unsupported network configuration'), ++ reporting.Summary( ++ 'Detected multiple physical network interfaces where one or more' ++ ' use kernel naming (e.g. eth0). Upgrade process cannot continue' ++ ' because stability of names can not be guaranteed.' ++ ), ++ reporting.Remediation(hint=hint_text), ++ reporting.Severity(reporting.Severity.HIGH), ++ reporting.Groups([reporting.Groups.NETWORK]), ++ reporting.Groups([reporting.Groups.INHIBITOR]) ++ ] + report_external_links ++ + create_report(report_entries) + + +diff --git a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +index 81b5a28c..4b8669bb 100644 +--- a/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py ++++ b/repos/system_upgrade/common/actors/persistentnetnamesdisable/tests/test_persistentnetnamesdisable.py +@@ -1,8 +1,11 @@ + import pytest + + from leapp.libraries.actor import persistentnetnamesdisable ++from leapp.libraries.common.testutils import create_report_mocked, CurrentActorMocked + from leapp.models import ( + Interface, ++ KernelCmdline, ++ KernelCmdlineArg, + PCIAddress, + PersistentNetNamesFacts, + TargetKernelCmdlineArgTasks, +@@ -65,6 +68,7 @@ def test_actor_single_eth0(current_actor_context): + 'target_version', ['9', '10'] + ) + def test_actor_more_ethX(monkeypatch, current_actor_context, target_version): ++ monkeypatch.setattr(persistentnetnamesdisable, 'get_source_major_version', lambda: str(int(target_version) - 1)) + monkeypatch.setattr(persistentnetnamesdisable, 'get_target_major_version', lambda: target_version) + pci1 = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") + pci2 = PCIAddress(domain="0000", bus="3d", function="00", device="Serial controller") +@@ -84,7 +88,10 @@ def test_actor_more_ethX(monkeypatch, current_actor_context, target_version): + pci_info=pci2, + devpath="/devices/hidraw/hidraw0") + ] +- current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) ++ current_actor_context.feed( ++ PersistentNetNamesFacts(interfaces=interface), ++ KernelCmdline(parameters=[KernelCmdlineArg(key='what', value='ever')]) ++ ) + current_actor_context.run() + + report_fields = current_actor_context.consume(Report)[0].report +@@ -122,6 +129,7 @@ def test_actor_single_int_not_ethX(current_actor_context): + 'target_version', ['9', '10'] + ) + def test_actor_ethX_and_not_ethX(monkeypatch, current_actor_context, target_version): ++ monkeypatch.setattr(persistentnetnamesdisable, 'get_source_major_version', lambda: str(int(target_version) - 1)) + monkeypatch.setattr(persistentnetnamesdisable, 'get_target_major_version', lambda: target_version) + pci1 = PCIAddress(domain="0000", bus="3e", function="00", device="PCI bridge") + pci2 = PCIAddress(domain="0000", bus="3d", function="00", device="Serial controller") +@@ -141,7 +149,10 @@ def test_actor_ethX_and_not_ethX(monkeypatch, current_actor_context, target_vers + pci_info=pci2, + devpath="/devices/hidraw/hidraw0") + ] +- current_actor_context.feed(PersistentNetNamesFacts(interfaces=interface)) ++ current_actor_context.feed( ++ PersistentNetNamesFacts(interfaces=interface), ++ KernelCmdline(parameters=[KernelCmdlineArg(key='what', value='ever')]) ++ ) + current_actor_context.run() + assert current_actor_context.consume(Report) + +@@ -158,3 +169,66 @@ def test_actor_ethX_and_not_ethX(monkeypatch, current_actor_context, target_vers + assert rhel8to9_present + else: + assert not rhel8to9_present ++ ++ ++@pytest.mark.parametrize(('result_expected', 'key', 'value'), ( ++ (True, 'net.ifnames', None), ++ (True, 'net.ifnames', '0'), ++ (False, 'net.ifname', None), ++ (False, 'inet.ifnames', None), ++ (False, 'missing', None), ++ (False, 'missing', 'whatever'), ++ (False, 'net.ifnames', '1'), ++)) ++def test_is_kernel_arg_present(monkeypatch, result_expected, key, value): ++ k_args = [ ++ KernelCmdlineArg(key='Foo', value='0'), ++ KernelCmdlineArg(key='net.ifnames', value='0'), ++ KernelCmdlineArg(key='Something', value='None'), ++ ] ++ curr_actor_mocked = CurrentActorMocked( ++ msgs=[KernelCmdline(parameters=k_args)] ++ ) ++ monkeypatch.setattr(persistentnetnamesdisable.api, 'current_actor', curr_actor_mocked) ++ assert result_expected is persistentnetnamesdisable.is_kernel_arg_present(key, value) ++ ++ ++@pytest.mark.parametrize(('naming_expected', 'k_args'), ( ++ (False, [KernelCmdlineArg(key='net.ifnames', value='0')]), ++ (True, [KernelCmdlineArg(key='net.ifnames', value='1')]), ++ (True, [KernelCmdlineArg(key='net.naming-scheme-foo', value='rhel-8.10')]), ++ ( ++ # NOTE(pstodulk): this is kind of nonsense, but let's test it ++ False, ++ [ ++ KernelCmdlineArg(key='net.naming-scheme', value='rhel-8.10'), ++ KernelCmdlineArg(key='net.ifnames', value='0'), ++ ] ++ ), ++ (False, [KernelCmdlineArg(key='net.naming-scheme', value='rhel-8.10')]), ++ (False, [KernelCmdlineArg(key='net.naming-scheme', value='rhel-9.10')]), ++)) ++@pytest.mark.parametrize('src_ver', ('8.10', '9.8', '10.6')) ++def test_report_ethx_ifaces_scheme(monkeypatch, naming_expected, src_ver, k_args): ++ _v_split = src_ver.split('.') ++ dst_ver = '{}.{}'.format(int(_v_split[0]) + 1, _v_split[1]) ++ curr_actor_mocked = CurrentActorMocked( ++ msgs=[KernelCmdline(parameters=k_args)], ++ src_ver=src_ver, ++ dst_ver=dst_ver ++ ) ++ monkeypatch.setattr(persistentnetnamesdisable, 'create_report', create_report_mocked()) ++ monkeypatch.setattr(persistentnetnamesdisable.api, 'current_actor', curr_actor_mocked) ++ ++ persistentnetnamesdisable.report_ethX_ifaces() ++ assert persistentnetnamesdisable.create_report.called ++ report = persistentnetnamesdisable.create_report.reports[0] ++ ++ if naming_expected: ++ url = 'https://red.ht/rhel-{}-consistent-nic-naming'.format(_v_split[0]) ++ assert any(url == link['url'] for link in report['detail']['external']) ++ assert 'net.naming-scheme' in report['detail']['remediations'][0]['context'] ++ else: ++ url_str = 'consistent-nic-naming' ++ assert not any(url_str in link['url'] for link in report['detail']['external']) ++ assert 'net.naming-scheme' not in report['detail']['remediations'][0]['context'] +-- +2.53.0 + diff --git a/0034-fix-quoting-in-list-representation-of-commands.patch b/0034-fix-quoting-in-list-representation-of-commands.patch new file mode 100644 index 0000000..42f104b --- /dev/null +++ b/0034-fix-quoting-in-list-representation-of-commands.patch @@ -0,0 +1,46 @@ +From 0706cb54f4d1ba953de5e348cb03f9553b952669 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Tue, 17 Mar 2026 13:01:17 +0100 +Subject: [PATCH 34/44] fix quoting in list representation of commands + +Removed redundant quotes included due to incorrect handling of command +conversion to string representation in leapp framework's reporting +module. The reporting module is fixed by RHEL-156521 and this patch is a +followup that fixes usage of the module so that the commands are +propagated to the leapp-report.txt correctly. + +Jira: RHEL-155517, RHEL-155515 +--- + .../actors/checkdnfpluginpath/libraries/checkdnfpluginpath.py | 2 +- + repos/system_upgrade/common/actors/checkrootsymlinks/actor.py | 2 +- + 2 files changed, 2 insertions(+), 2 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkdnfpluginpath/libraries/checkdnfpluginpath.py b/repos/system_upgrade/common/actors/checkdnfpluginpath/libraries/checkdnfpluginpath.py +index ce705361..be169e7e 100644 +--- a/repos/system_upgrade/common/actors/checkdnfpluginpath/libraries/checkdnfpluginpath.py ++++ b/repos/system_upgrade/common/actors/checkdnfpluginpath/libraries/checkdnfpluginpath.py +@@ -21,7 +21,7 @@ def check_dnf_pluginpath(dnf_pluginpath_detected): + reporting.Remediation( + hint='Remove or comment out the pluginpath option in the DNF ' + 'configuration file to be able to upgrade the system', +- commands=[['sed', '-i', '\'s/^pluginpath[[:space:]]*=/#pluginpath=/\'', DNF_CONFIG_PATH]], ++ commands=[['sed', '-i', 's/^pluginpath[[:space:]]*=/#pluginpath=/', DNF_CONFIG_PATH]], + ), + reporting.Severity(reporting.Severity.HIGH), + reporting.Groups([reporting.Groups.INHIBITOR]), +diff --git a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +index 7b89bf7a..bee672bf 100644 +--- a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py ++++ b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +@@ -55,7 +55,7 @@ class CheckRootSymlinks(Actor): + os.path.relpath(item.target, '/'), + os.path.join('/', item.name)]) + commands.append(command) +- rem_commands = [['sh', '-c', '"{}"'.format(' && '.join(commands))]] ++ rem_commands = [['sh', '-c', '{}'.format(' && '.join(commands))]] + # Generate reports about non-utf8 absolute links presence + nonutf_count = len(absolute_links_nonutf) + if nonutf_count > 0: +-- +2.53.0 + diff --git a/0035-fixup-fix-quoting-in-list-representation-of-commands.patch b/0035-fixup-fix-quoting-in-list-representation-of-commands.patch new file mode 100644 index 0000000..03335d6 --- /dev/null +++ b/0035-fixup-fix-quoting-in-list-representation-of-commands.patch @@ -0,0 +1,116 @@ +From a71fb36ca529b323a904adc2e9048a93074bf723 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Wed, 25 Mar 2026 18:01:42 +0100 +Subject: [PATCH 35/44] fixup! fix quoting in list representation of commands + +--- + packaging/leapp-repository.spec | 2 +- + .../common/actors/checkrootsymlinks/actor.py | 6 +++--- + .../libraries/checkyumpluginsenabled.py | 2 +- + .../common/actors/verifydialogs/libraries/verifydialogs.py | 7 ++++--- + .../actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py | 6 +++--- + .../actors/inhibitcgroupsv1/tests/test_inhibitcgroupsv1.py | 4 ++-- + 6 files changed, 14 insertions(+), 13 deletions(-) + +diff --git a/packaging/leapp-repository.spec b/packaging/leapp-repository.spec +index 97bc261a..3ffafafa 100644 +--- a/packaging/leapp-repository.spec ++++ b/packaging/leapp-repository.spec +@@ -120,7 +120,7 @@ Requires: leapp-repository-dependencies = %{leapp_repo_deps} + + # IMPORTANT: this is capability provided by the leapp framework rpm. + # Check that 'version' instead of the real framework rpm version. +-Requires: leapp-framework >= 6.2, leapp-framework < 7 ++Requires: leapp-framework >= 6.4, leapp-framework < 7 + + # Since we provide sub-commands for the leapp utility, we expect the leapp + # tool to be installed as well. +diff --git a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +index bee672bf..2e805542 100644 +--- a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py ++++ b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +@@ -52,10 +52,10 @@ class CheckRootSymlinks(Actor): + for item in absolute_links: + command = ' '.join(['ln', + '-snf', +- os.path.relpath(item.target, '/'), +- os.path.join('/', item.name)]) ++ f"'{os.path.relpath(item.target, '/')}'", ++ f"'{os.path.join('/', item.name)}'"]) + commands.append(command) +- rem_commands = [['sh', '-c', '{}'.format(' && '.join(commands))]] ++ rem_commands = [['bash', '-c', '{}'.format(' && '.join(commands))]] + # Generate reports about non-utf8 absolute links presence + nonutf_count = len(absolute_links_nonutf) + if nonutf_count > 0: +diff --git a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +index 87ff6511..9afa51ac 100644 +--- a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py ++++ b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +@@ -53,7 +53,7 @@ def check_required_dnf_plugins_enabled(pkg_manager_info): + .format(dnf_conf_path, plugin_configs_dir) + ), + # Provide all commands as one due to problems with satellites +- commands=[['bash', '-c', '"{0}"'.format('; '.join(remediation_commands))]] ++ commands=[['bash', '-c', '{0}'.format('; '.join(remediation_commands))]] + ), + reporting.ExternalLink( + url='https://access.redhat.com/solutions/7028063', +diff --git a/repos/system_upgrade/common/actors/verifydialogs/libraries/verifydialogs.py b/repos/system_upgrade/common/actors/verifydialogs/libraries/verifydialogs.py +index a79079b1..84b745ca 100644 +--- a/repos/system_upgrade/common/actors/verifydialogs/libraries/verifydialogs.py ++++ b/repos/system_upgrade/common/actors/verifydialogs/libraries/verifydialogs.py +@@ -13,13 +13,14 @@ def check_dialogs(inhibit_if_no_userchoice=True): + dialogs_remediation = ('Please register user choices with leapp answer cli command or by manually editing ' + 'the answerfile.') + # FIXME: Enable more choices once we can do multi-command remediations +- cmd_remediation = [['leapp', 'answer', '--section', "{}={}".format(s, choice)] +- for s, choices in dialog.answerfile_sections.items() for choice in choices[:1]] ++ cmd_remediations = [['leapp', 'answer', '--section', '{}={}'.format(s, choice)] ++ for s, choices in dialog.answerfile_sections.items() ++ for choice in choices[:1]] + report_data = [reporting.Title('Missing required answers in the answer file'), + reporting.Severity(reporting.Severity.HIGH), + reporting.Summary(summary.format('\n'.join(sections))), + reporting.Groups([reporting.Groups.INHIBITOR] if inhibit_if_no_userchoice else []), +- reporting.Remediation(hint=dialogs_remediation, commands=cmd_remediation), ++ reporting.Remediation(hint=dialogs_remediation, commands=cmd_remediations), + reporting.ExternalLink( + url='https://access.redhat.com/solutions/7035321', + title='Leapp upgrade fail with error "Inhibitor: Missing required answers ' +diff --git a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py +index 6ae41be2..a54883b2 100644 +--- a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py ++++ b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/libraries/inhibitcgroupsv1.py +@@ -49,9 +49,9 @@ def process(): + # remove the args from commandline, the defaults are the desired values + commands=[ + [ +- "grubby", +- "--update-kernel=ALL", +- '--remove-args="{}"'.format(" ".join(remediation_cmd_args)), ++ 'grubby', ++ '--update-kernel', 'ALL', ++ '--remove-args', '{}'.format(' '.join(remediation_cmd_args)) + ], + ], + ), +diff --git a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/tests/test_inhibitcgroupsv1.py b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/tests/test_inhibitcgroupsv1.py +index 9b3ec96f..629e8798 100644 +--- a/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/tests/test_inhibitcgroupsv1.py ++++ b/repos/system_upgrade/el9toel10/actors/inhibitcgroupsv1/tests/test_inhibitcgroupsv1.py +@@ -39,9 +39,9 @@ def test_inhibit_should_inhibit(monkeypatch, cmdline_params): + assert reporting.Groups.INHIBITOR in report["groups"] + + command = [r for r in report["detail"]["remediations"] if r["type"] == "command"][0] +- assert "systemd.unified_cgroup_hierarchy" in command['context'][2] ++ assert "systemd.unified_cgroup_hierarchy" in command['context'][4] + if len(cmdline_params) == 2: +- assert "systemd.legacy_systemd_cgroup_controller" in command['context'][2] ++ assert "systemd.legacy_systemd_cgroup_controller" in command['context'][4] + + + @pytest.mark.parametrize( +-- +2.53.0 + diff --git a/0036-pulseaudiocheck-Add-PulseAudio-config-check-for-RHEL.patch b/0036-pulseaudiocheck-Add-PulseAudio-config-check-for-RHEL.patch new file mode 100644 index 0000000..45ac1a0 --- /dev/null +++ b/0036-pulseaudiocheck-Add-PulseAudio-config-check-for-RHEL.patch @@ -0,0 +1,533 @@ +From 7d29232bdc45e15401d24a86f5508c3b3de826d1 Mon Sep 17 00:00:00 2001 +From: Tomas Pelka +Date: Thu, 2 Apr 2026 09:24:33 +0200 +Subject: [PATCH 36/44] pulseaudiocheck: Add PulseAudio config check for RHEL 9 + to 10 upgrade + +PulseAudio is replaced by PipeWire in RHEL 10. Add a scanner/checker +actor pair that detects custom PulseAudio configuration which won't +carry over after the upgrade. + +The scanner (FactsCollectionPhase) checks for: +- Modified default config files via RPM verification +- Drop-in fragments in /etc/pulse/default.pa.d/ and system.pa.d/ +- Per-user configuration in ~/.config/pulse/ + +The checker (ChecksPhase) consumes the scan results and produces +a report with a link to the PipeWire migration guide. + +Resolves: DESKTOP-1151 +--- + .../pulseaudiocheck/checkpulseaudio/actor.py | 20 +++ + .../libraries/checkpulseaudio.py | 86 ++++++++++++ + .../tests/test_checkpulseaudio.py | 127 ++++++++++++++++++ + .../pulseaudiocheck/scanpulseaudio/actor.py | 20 +++ + .../libraries/scanpulseaudio.py | 98 ++++++++++++++ + .../tests/test_scanpulseaudio.py | 77 +++++++++++ + .../models/pulseaudioconfiguration.py | 24 ++++ + 7 files changed, 452 insertions(+) + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/actor.py + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/libraries/checkpulseaudio.py + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/tests/test_checkpulseaudio.py + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/actor.py + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/libraries/scanpulseaudio.py + create mode 100644 repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/tests/test_scanpulseaudio.py + create mode 100644 repos/system_upgrade/el9toel10/models/pulseaudioconfiguration.py + +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/actor.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/actor.py +new file mode 100644 +index 00000000..9417d6d6 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/actor.py +@@ -0,0 +1,20 @@ ++from leapp.actors import Actor ++from leapp.libraries.actor.checkpulseaudio import check_pulseaudio ++from leapp.models import DistributionSignedRPM, PulseAudioConfiguration, Report ++from leapp.tags import ChecksPhaseTag, IPUWorkflowTag ++ ++ ++class CheckPulseAudio(Actor): ++ """ ++ Check for custom PulseAudio configuration that won't carry over after upgrade. ++ ++ PulseAudio is replaced by PipeWire with the pipewire-pulseaudio compatibility ++ plugin in RHEL 10. Custom PulseAudio configuration will not be applied. ++ """ ++ name = 'check_pulseaudio' ++ consumes = (DistributionSignedRPM, PulseAudioConfiguration) ++ produces = (Report,) ++ tags = (ChecksPhaseTag, IPUWorkflowTag) ++ ++ def process(self): ++ check_pulseaudio() +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/libraries/checkpulseaudio.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/libraries/checkpulseaudio.py +new file mode 100644 +index 00000000..0453ca05 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/libraries/checkpulseaudio.py +@@ -0,0 +1,86 @@ ++from leapp import reporting ++from leapp.libraries.common.distro import DISTRO_REPORT_NAMES ++from leapp.libraries.common.rpms import has_package ++from leapp.libraries.stdlib import api ++from leapp.models import DistributionSignedRPM, PulseAudioConfiguration ++ ++FMT_LIST_SEPARATOR = '\n - ' ++ ++ ++def _report_custom_pulseaudio_config(modified_defaults, dropin_dirs, user_config_dirs): ++ """ ++ Create a report warning about custom PulseAudio configuration. ++ ++ :param modified_defaults: list of modified default config files ++ :type modified_defaults: list ++ :param dropin_dirs: list of drop-in directories with content ++ :type dropin_dirs: list ++ :param user_config_dirs: list of per-user config directories ++ :type user_config_dirs: list ++ """ ++ details = [] ++ if modified_defaults: ++ details.append( ++ 'The following default PulseAudio configuration files have been modified:{sep}{files}'.format( ++ sep=FMT_LIST_SEPARATOR, ++ files=FMT_LIST_SEPARATOR.join(modified_defaults), ++ ) ++ ) ++ if dropin_dirs: ++ details.append( ++ 'The following PulseAudio drop-in configuration directories contain custom ' ++ 'fragments:{sep}{dirs}'.format( ++ sep=FMT_LIST_SEPARATOR, ++ dirs=FMT_LIST_SEPARATOR.join(dropin_dirs), ++ ) ++ ) ++ if user_config_dirs: ++ details.append( ++ 'Per-user PulseAudio configuration was found in:{sep}{dirs}'.format( ++ sep=FMT_LIST_SEPARATOR, ++ dirs=FMT_LIST_SEPARATOR.join(user_config_dirs), ++ ) ++ ) ++ ++ summary = ( ++ 'PulseAudio is replaced by PipeWire in {target_distro} 10. The PipeWire pipewire-pulseaudio plugin provides ' ++ 'compatibility with the default PulseAudio configuration, but custom PulseAudio configuration will ' ++ 'not be applied after the upgrade. Review your PulseAudio configuration and migrate any custom ' ++ 'settings to PipeWire equivalents after upgrading.' ++ ).format_map(DISTRO_REPORT_NAMES) ++ if details: ++ summary += '\n\n' + '\n\n'.join(details) ++ ++ all_paths = modified_defaults + dropin_dirs + user_config_dirs ++ reporting.create_report([ ++ reporting.Title('Custom PulseAudio configuration detected'), ++ reporting.Summary(summary), ++ reporting.Severity(reporting.Severity.MEDIUM), ++ reporting.Groups([reporting.Groups.SERVICES]), ++ reporting.ExternalLink(title='Migrate PulseAudio to PipeWire', ++ url='https://gitlab.freedesktop.org/pipewire/pipewire/-/wikis/Migrate-PulseAudio'), ++ reporting.Remediation( ++ hint='Review your PulseAudio configuration and plan to migrate custom settings to PipeWire ' ++ 'after the upgrade. The pipewire-pulseaudio plugin handles default configuration automatically.' ++ ), ++ reporting.RelatedResource('package', 'pulseaudio'), ++ ] + [reporting.RelatedResource('file', f) for f in all_paths]) ++ ++ ++def check_pulseaudio(): ++ """ ++ Consume PulseAudioConfiguration and generate report if custom config is found. ++ """ ++ if not has_package(DistributionSignedRPM, 'pulseaudio'): ++ api.current_logger().debug('PulseAudio is not installed, skipping check.') ++ return ++ ++ msg = next(api.consume(PulseAudioConfiguration), None) ++ if not msg: ++ api.current_logger().debug('No PulseAudioConfiguration message received.') ++ return ++ ++ if msg.modified_defaults or msg.dropin_dirs or msg.user_config_dirs: ++ _report_custom_pulseaudio_config(msg.modified_defaults, msg.dropin_dirs, msg.user_config_dirs) ++ else: ++ api.current_logger().info('No custom PulseAudio configuration detected.') +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/tests/test_checkpulseaudio.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/tests/test_checkpulseaudio.py +new file mode 100644 +index 00000000..518bfb73 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/checkpulseaudio/tests/test_checkpulseaudio.py +@@ -0,0 +1,127 @@ ++from leapp import reporting ++from leapp.libraries.actor.checkpulseaudio import check_pulseaudio ++from leapp.libraries.common.testutils import create_report_mocked, CurrentActorMocked ++from leapp.libraries.stdlib import api ++from leapp.models import DistributionSignedRPM, PulseAudioConfiguration, RPM ++ ++ ++def _generate_rpm_with_name(name): ++ """ ++ Generate new RPM model item with given name. ++ ++ :param name: rpm name ++ :type name: str ++ :return: new RPM object with name parameter set ++ :rtype: RPM ++ """ ++ return RPM(name=name, ++ version='0.1', ++ release='1.sm01', ++ epoch='1', ++ pgpsig='RSA/SHA256, Mon 01 Jan 1970 00:00:00 AM -03, Key ID 199e2f91fd431d51', ++ packager='Red Hat, Inc. ', ++ arch='noarch') ++ ++ ++class TestCheckPulseaudio: ++ """Tests for check_pulseaudio checker function.""" ++ ++ def test_pulseaudio_not_installed(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('some-other-package')] ++ msg = PulseAudioConfiguration(modified_defaults=['/etc/pulse/daemon.conf']) ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert not reporting.create_report.called ++ ++ def test_no_message(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms)]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert not reporting.create_report.called ++ ++ def test_no_custom_config(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ msg = PulseAudioConfiguration() ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert not reporting.create_report.called ++ ++ def test_modified_defaults(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ msg = PulseAudioConfiguration( ++ modified_defaults=['/etc/pulse/daemon.conf'], ++ ) ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert reporting.create_report.called == 1 ++ report_fields = reporting.create_report.report_fields ++ assert 'Custom PulseAudio configuration detected' in report_fields['title'] ++ assert '/etc/pulse/daemon.conf' in report_fields['summary'] ++ ++ def test_dropin_dirs(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ msg = PulseAudioConfiguration( ++ dropin_dirs=['/etc/pulse/default.pa.d'], ++ ) ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert reporting.create_report.called == 1 ++ report_fields = reporting.create_report.report_fields ++ assert '/etc/pulse/default.pa.d' in report_fields['summary'] ++ ++ def test_user_config_dirs(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ msg = PulseAudioConfiguration( ++ user_config_dirs=['/home/admin/.config/pulse'], ++ ) ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert reporting.create_report.called == 1 ++ report_fields = reporting.create_report.report_fields ++ assert '/home/admin/.config/pulse' in report_fields['summary'] ++ ++ def test_report_all_sources(self, monkeypatch): ++ rpms = [_generate_rpm_with_name('pulseaudio')] ++ msg = PulseAudioConfiguration( ++ modified_defaults=['/etc/pulse/daemon.conf'], ++ dropin_dirs=['/etc/pulse/default.pa.d'], ++ user_config_dirs=['/root/.config/pulse'], ++ ) ++ curr_actor_mocked = CurrentActorMocked(msgs=[DistributionSignedRPM(items=rpms), msg]) ++ monkeypatch.setattr(api, 'current_actor', curr_actor_mocked) ++ monkeypatch.setattr(reporting, 'create_report', create_report_mocked()) ++ ++ check_pulseaudio() ++ ++ assert reporting.create_report.called == 1 ++ report_fields = reporting.create_report.report_fields ++ resources = report_fields['detail']['related_resources'] ++ pkg_resources = [r for r in resources if r['scheme'] == 'package'] ++ file_resources = [r for r in resources if r['scheme'] == 'file'] ++ assert len(pkg_resources) == 1 ++ assert pkg_resources[0]['title'] == 'pulseaudio' ++ assert len(file_resources) == 3 +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/actor.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/actor.py +new file mode 100644 +index 00000000..5614c802 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/actor.py +@@ -0,0 +1,20 @@ ++from leapp.actors import Actor ++from leapp.libraries.actor.scanpulseaudio import scan_pulseaudio ++from leapp.models import PulseAudioConfiguration ++from leapp.tags import FactsPhaseTag, IPUWorkflowTag ++ ++ ++class ScanPulseAudio(Actor): ++ """ ++ Scan the system for PulseAudio custom configuration. ++ ++ Detects whether PulseAudio is installed and checks for custom ++ configuration that will not carry over to PipeWire after upgrade. ++ """ ++ name = 'scan_pulseaudio' ++ consumes = () ++ produces = (PulseAudioConfiguration,) ++ tags = (FactsPhaseTag, IPUWorkflowTag) ++ ++ def process(self): ++ self.produce(scan_pulseaudio()) +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/libraries/scanpulseaudio.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/libraries/scanpulseaudio.py +new file mode 100644 +index 00000000..e5c2be53 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/libraries/scanpulseaudio.py +@@ -0,0 +1,98 @@ ++import os ++import pwd ++ ++from leapp.libraries.common.rpms import check_file_modification ++from leapp.models import PulseAudioConfiguration ++ ++# System-wide PulseAudio configuration directory ++PULSEAUDIO_CONFIG_DIR = '/etc/pulse' ++ ++# Drop-in directories included from default.pa and system.pa ++_DROPIN_DIRS = ( ++ '/etc/pulse/default.pa.d', ++ '/etc/pulse/system.pa.d', ++) ++ ++# Files that are part of the default PulseAudio installation ++_DEFAULT_CONFIG_FILES = frozenset(( ++ 'client.conf', ++ 'daemon.conf', ++ 'default.pa', ++ 'system.pa', ++)) ++ ++# Per-user PulseAudio config directory relative to home ++_USER_CONFIG_SUBDIR = '.config/pulse' ++ ++ ++def _get_dropin_dirs_with_content(): ++ """ ++ Return list of drop-in directories that exist and contain files. ++ ++ PulseAudio includes fragments from /etc/pulse/default.pa.d/ and ++ /etc/pulse/system.pa.d/ via .include directives. These directories ++ do not exist by default. ++ ++ :return: list of drop-in directory paths that contain files ++ :rtype: list ++ """ ++ found = [] ++ for dropin_dir in _DROPIN_DIRS: ++ if os.path.isdir(dropin_dir) and os.listdir(dropin_dir): ++ found.append(dropin_dir) ++ return found ++ ++ ++def _get_user_config_dirs(): ++ """ ++ Return list of user home directories that contain PulseAudio configuration. ++ ++ Checks ~/.config/pulse/ for each user with a valid home directory. ++ ++ :return: list of per-user PulseAudio config directory paths ++ :rtype: list ++ """ ++ found = [] ++ for user in pwd.getpwall(): ++ pulse_dir = os.path.join(user.pw_dir, _USER_CONFIG_SUBDIR) ++ if os.path.isdir(pulse_dir) and os.listdir(pulse_dir): ++ found.append(pulse_dir) ++ return sorted(found) ++ ++ ++def _check_default_configs_modified(): ++ """ ++ Check whether any of the default PulseAudio config files have been modified. ++ ++ Uses RPM verification to detect changes to files owned by the pulseaudio ++ package. Returns list of modified default config file paths. ++ ++ :return: list of modified default config file paths ++ :rtype: list ++ """ ++ modified = [] ++ for filename in sorted(_DEFAULT_CONFIG_FILES): ++ filepath = os.path.join(PULSEAUDIO_CONFIG_DIR, filename) ++ if os.path.isfile(filepath): ++ if check_file_modification(filepath): ++ modified.append(filepath) ++ ++ return modified ++ ++ ++def scan_pulseaudio(): ++ """ ++ Scan the system for PulseAudio configuration and return findings. ++ ++ :return: PulseAudioConfiguration message with scan results ++ :rtype: PulseAudioConfiguration ++ """ ++ modified_defaults = _check_default_configs_modified() ++ dropin_dirs = _get_dropin_dirs_with_content() ++ user_config_dirs = _get_user_config_dirs() ++ ++ return PulseAudioConfiguration( ++ modified_defaults=modified_defaults, ++ dropin_dirs=dropin_dirs, ++ user_config_dirs=user_config_dirs, ++ ) +diff --git a/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/tests/test_scanpulseaudio.py b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/tests/test_scanpulseaudio.py +new file mode 100644 +index 00000000..f499aafe +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/actors/pulseaudiocheck/scanpulseaudio/tests/test_scanpulseaudio.py +@@ -0,0 +1,77 @@ ++import os ++ ++from leapp.libraries.actor import scanpulseaudio ++from leapp.libraries.actor.scanpulseaudio import _get_dropin_dirs_with_content, _get_user_config_dirs, scan_pulseaudio ++ ++ ++class TestGetDropinDirsWithContent: ++ """Tests for _get_dropin_dirs_with_content.""" ++ ++ def test_no_dropin_dirs(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda _: False) ++ assert _get_dropin_dirs_with_content() == [] ++ ++ def test_empty_dropin_dirs(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda _: True) ++ monkeypatch.setattr(os, 'listdir', lambda _: []) ++ assert _get_dropin_dirs_with_content() == [] ++ ++ def test_dropin_dirs_with_content(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda _: True) ++ monkeypatch.setattr(os, 'listdir', lambda _: ['custom.conf']) ++ result = _get_dropin_dirs_with_content() ++ assert result == ['/etc/pulse/default.pa.d', '/etc/pulse/system.pa.d'] ++ ++ def test_only_one_dropin_dir_exists(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda path: path == '/etc/pulse/default.pa.d') ++ monkeypatch.setattr(os, 'listdir', lambda _: ['custom.conf']) ++ result = _get_dropin_dirs_with_content() ++ assert result == ['/etc/pulse/default.pa.d'] ++ ++ ++class TestGetUserConfigDirs: ++ """Tests for _get_user_config_dirs.""" ++ ++ def test_no_user_config(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda _: False) ++ assert _get_user_config_dirs() == [] ++ ++ def test_user_config_found(self, monkeypatch): ++ monkeypatch.setattr(os.path, 'isdir', lambda path: path == '/home/testuser/.config/pulse') ++ monkeypatch.setattr(os, 'listdir', lambda _: ['default.pa']) ++ ++ class FakeUser: ++ pw_dir = '/home/testuser' ++ ++ monkeypatch.setattr(scanpulseaudio.pwd, 'getpwall', lambda: [FakeUser()]) ++ result = _get_user_config_dirs() ++ assert result == ['/home/testuser/.config/pulse'] ++ ++ ++class TestScanPulseaudio: ++ """Tests for scan_pulseaudio main function.""" ++ ++ def test_no_custom_config(self, monkeypatch): ++ monkeypatch.setattr(scanpulseaudio, '_check_default_configs_modified', lambda: []) ++ monkeypatch.setattr(scanpulseaudio, '_get_dropin_dirs_with_content', lambda: []) ++ monkeypatch.setattr(scanpulseaudio, '_get_user_config_dirs', lambda: []) ++ ++ result = scan_pulseaudio() ++ ++ assert result.modified_defaults == [] ++ assert result.dropin_dirs == [] ++ assert result.user_config_dirs == [] ++ ++ def test_with_all_findings(self, monkeypatch): ++ monkeypatch.setattr(scanpulseaudio, '_check_default_configs_modified', ++ lambda: ['/etc/pulse/daemon.conf']) ++ monkeypatch.setattr(scanpulseaudio, '_get_dropin_dirs_with_content', ++ lambda: ['/etc/pulse/default.pa.d']) ++ monkeypatch.setattr(scanpulseaudio, '_get_user_config_dirs', ++ lambda: ['/root/.config/pulse']) ++ ++ result = scan_pulseaudio() ++ ++ assert result.modified_defaults == ['/etc/pulse/daemon.conf'] ++ assert result.dropin_dirs == ['/etc/pulse/default.pa.d'] ++ assert result.user_config_dirs == ['/root/.config/pulse'] +diff --git a/repos/system_upgrade/el9toel10/models/pulseaudioconfiguration.py b/repos/system_upgrade/el9toel10/models/pulseaudioconfiguration.py +new file mode 100644 +index 00000000..bfb7aa22 +--- /dev/null ++++ b/repos/system_upgrade/el9toel10/models/pulseaudioconfiguration.py +@@ -0,0 +1,24 @@ ++from leapp.models import fields, Model ++from leapp.topics import SystemInfoTopic ++ ++ ++class PulseAudioConfiguration(Model): ++ """ ++ Model describing the state of PulseAudio configuration on the system. ++ """ ++ topic = SystemInfoTopic ++ ++ modified_defaults = fields.List(fields.String(), default=[]) ++ """ ++ Default config files modified from RPM originals (full paths) ++ """ ++ ++ dropin_dirs = fields.List(fields.String(), default=[]) ++ """ ++ Drop-in directories that exist and contain files (full paths) ++ """ ++ ++ user_config_dirs = fields.List(fields.String(), default=[]) ++ """ ++ Per-user config directories that exist and contain files (full paths) ++ """ +-- +2.53.0 + diff --git a/0037-fix-checkyumpluginsenabled-correctly-create-remediat.patch b/0037-fix-checkyumpluginsenabled-correctly-create-remediat.patch new file mode 100644 index 0000000..73c8c07 --- /dev/null +++ b/0037-fix-checkyumpluginsenabled-correctly-create-remediat.patch @@ -0,0 +1,31 @@ +From 87c192519e8764f59516cca563816f062428a533 Mon Sep 17 00:00:00 2001 +From: Peter Mocary +Date: Thu, 2 Apr 2026 16:28:48 +0200 +Subject: [PATCH 37/44] fix(checkyumpluginsenabled): correctly create + remediation command + +The remediation command for the inhibitor triggered when required dnf +plugins are not enabled was created incorrectly. This patch fixes the +command creation. +--- + .../libraries/checkyumpluginsenabled.py | 4 ++-- + 1 file changed, 2 insertions(+), 2 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +index 9afa51ac..869e2a88 100644 +--- a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py ++++ b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +@@ -36,8 +36,8 @@ def check_required_dnf_plugins_enabled(pkg_manager_info): + product_id_plugin_conf = os.path.join(plugin_configs_dir, 'product-id.conf') + + remediation_commands = [ +- f"sed -i 's/^plugins=0/plugins=1/' '{dnf_conf_path}'" +- f"sed -i 's/^enabled=0/enabled=1/' '{rhsm_plugin_conf}'" ++ f"sed -i 's/^plugins=0/plugins=1/' '{dnf_conf_path}'", ++ f"sed -i 's/^enabled=0/enabled=1/' '{rhsm_plugin_conf}'", + f"sed -i 's/^enabled=0/enabled=1/' '{product_id_plugin_conf}'" + ] + +-- +2.53.0 + diff --git a/0038-fix-rhui-consider-source-clients-always-signed.patch b/0038-fix-rhui-consider-source-clients-always-signed.patch new file mode 100644 index 0000000..14a96cd --- /dev/null +++ b/0038-fix-rhui-consider-source-clients-always-signed.patch @@ -0,0 +1,201 @@ +From 0cfeee9fa113690c7e58877edf65842aad7d7ce5 Mon Sep 17 00:00:00 2001 +From: Michal Hecko +Date: Fri, 27 Mar 2026 13:53:49 +0100 +Subject: [PATCH 38/44] fix(rhui): consider source clients always signed + +Previously, all RHUI clients mentioned in the cloud map in the rhui.py +library were considered as signed by RH. However, configs allow using +clients that are not known to leapp, and, therefore, such clients would +not be considered as signed. Consequently, these packages would not be +removed, causing the upgrade to fail. This patch changes this behavior +so that all source clients mentioned in the RHUIInfo message are +considered as signed. +--- + .../filterrpmtransactionevents/actor.py | 12 +- + .../tests/test_filterrpmtransactionevents.py | 120 +++++++++++++++++- + 2 files changed, 125 insertions(+), 7 deletions(-) + +diff --git a/repos/system_upgrade/common/actors/filterrpmtransactionevents/actor.py b/repos/system_upgrade/common/actors/filterrpmtransactionevents/actor.py +index 582a5821..aa735da3 100644 +--- a/repos/system_upgrade/common/actors/filterrpmtransactionevents/actor.py ++++ b/repos/system_upgrade/common/actors/filterrpmtransactionevents/actor.py +@@ -1,8 +1,11 @@ + from leapp.actors import Actor ++from leapp.libraries.common.rpms import has_package + from leapp.models import ( + DistributionSignedRPM, + FilteredRpmTransactionTasks, ++ InstalledRPM, + PESRpmTransactionTasks, ++ RHUIInfo, + RpmTransactionTasks + ) + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag +@@ -18,7 +21,7 @@ class FilterRpmTransactionTasks(Actor): + """ + + name = 'check_rpm_transaction_events' +- consumes = (PESRpmTransactionTasks, RpmTransactionTasks, DistributionSignedRPM,) ++ consumes = (PESRpmTransactionTasks, RpmTransactionTasks, DistributionSignedRPM, RHUIInfo, InstalledRPM) + produces = (FilteredRpmTransactionTasks,) + tags = (IPUWorkflowTag, ChecksPhaseTag) + +@@ -27,6 +30,13 @@ class FilterRpmTransactionTasks(Actor): + for rpm_pkgs in self.consume(DistributionSignedRPM): + installed_pkgs.update([pkg.name for pkg in rpm_pkgs.items]) + ++ # Consider all RHUI source clients as signed, so that we can always remove them ++ rhui_info = next(self.consume(RHUIInfo), None) ++ if rhui_info: ++ for source_client in rhui_info.src_client_pkg_names: ++ if has_package(InstalledRPM, source_client): ++ installed_pkgs.add(source_client) ++ + local_rpms = set() + to_install = set() + to_remove = set() +diff --git a/repos/system_upgrade/common/actors/filterrpmtransactionevents/tests/test_filterrpmtransactionevents.py b/repos/system_upgrade/common/actors/filterrpmtransactionevents/tests/test_filterrpmtransactionevents.py +index 7173805e..a228ed07 100644 +--- a/repos/system_upgrade/common/actors/filterrpmtransactionevents/tests/test_filterrpmtransactionevents.py ++++ b/repos/system_upgrade/common/actors/filterrpmtransactionevents/tests/test_filterrpmtransactionevents.py +@@ -1,7 +1,37 @@ +-from leapp.models import DistributionSignedRPM, FilteredRpmTransactionTasks, Module, RPM, RpmTransactionTasks ++from leapp.models import ( ++ DistributionSignedRPM, ++ FilteredRpmTransactionTasks, ++ InstalledRPM, ++ Module, ++ RHUIInfo, ++ RPM, ++ RpmTransactionTasks, ++ TargetRHUIPostInstallTasks, ++ TargetRHUIPreInstallTasks, ++ TargetRHUISetupInfo ++) + from leapp.snactor.fixture import current_actor_context + + RH_PACKAGER = 'Red Hat, Inc. ' ++UNSIGNED_PACKAGER = 'Third Party ' ++ ++ ++def _make_rpm(name, packager=RH_PACKAGER): ++ return RPM(name=name, version='0.1', release='1.sm01', epoch='1', ++ packager=packager, arch='noarch', pgpsig='SOME_PGP_SIG') ++ ++ ++def _make_rhui_info(src_clients, target_clients, provider='azure'): ++ setup_info = TargetRHUISetupInfo( ++ preinstall_tasks=TargetRHUIPreInstallTasks(), ++ postinstall_tasks=TargetRHUIPostInstallTasks(), ++ ) ++ return RHUIInfo( ++ provider=provider, ++ src_client_pkg_names=src_clients, ++ target_client_pkg_names=target_clients, ++ target_client_setup_info=setup_info, ++ ) + + + def test_actor_execution(current_actor_context): +@@ -10,11 +40,7 @@ def test_actor_execution(current_actor_context): + + + def test_actor_execution_with_sample_data(current_actor_context): +- installed_rpm = [ +- RPM(name='sample01', version='0.1', release='1.sm01', epoch='1', packager=RH_PACKAGER, arch='noarch', +- pgpsig='SOME_PGP_SIG'), +- RPM(name='sample02', version='0.1', release='1.sm01', epoch='1', packager=RH_PACKAGER, arch='noarch', +- pgpsig='SOME_PGP_SIG')] ++ installed_rpm = [_make_rpm('sample01'), _make_rpm('sample02')] + modules_to_enable = [Module(name='enable', stream='1'), Module(name='enable', stream='2')] + modules_to_reset = [Module(name='reset', stream='1'), Module(name='reset', stream='2')] + current_actor_context.feed(DistributionSignedRPM(items=installed_rpm)) +@@ -43,3 +69,85 @@ def test_actor_execution_with_sample_data(current_actor_context): + assert all(m.name == 'reset' for m in result[0].modules_to_reset) + assert '1' in {m.stream for m in result[0].modules_to_reset} + assert '2' in {m.stream for m in result[0].modules_to_reset} ++ ++ ++def test_rhui_source_client_treated_as_signed(current_actor_context): ++ """Installed RHUI source clients should be removable even if they are not distribution-signed.""" ++ rhui_client_rpm = _make_rpm('rhui-azure-rhel8', packager=UNSIGNED_PACKAGER) ++ signed_rpm = _make_rpm('sample01') ++ ++ current_actor_context.feed(DistributionSignedRPM(items=[signed_rpm])) ++ current_actor_context.feed(InstalledRPM(items=[rhui_client_rpm, signed_rpm])) ++ current_actor_context.feed(_make_rhui_info(['rhui-azure-rhel8'], ['rhui-azure-rhel9'])) ++ current_actor_context.feed(RpmTransactionTasks(to_remove=['rhui-azure-rhel8'])) ++ current_actor_context.run() ++ ++ result = current_actor_context.consume(FilteredRpmTransactionTasks) ++ assert len(result) == 1 ++ assert 'rhui-azure-rhel8' in result[0].to_remove ++ ++ ++def test_rhui_source_client_not_installed_is_ignored(current_actor_context): ++ """RHUI source clients that are not installed should not be added to the installed set.""" ++ signed_rpm = _make_rpm('sample01') ++ ++ current_actor_context.feed(DistributionSignedRPM(items=[signed_rpm])) ++ current_actor_context.feed(InstalledRPM(items=[signed_rpm])) ++ current_actor_context.feed(_make_rhui_info(['rhui-azure-rhel8'], ['rhui-azure-rhel9'])) ++ current_actor_context.feed(RpmTransactionTasks(to_remove=['rhui-azure-rhel8'])) ++ current_actor_context.run() ++ ++ result = current_actor_context.consume(FilteredRpmTransactionTasks) ++ assert len(result) == 1 ++ assert 'rhui-azure-rhel8' not in result[0].to_remove ++ ++ ++def test_no_rhui_info_unsigned_pkg_not_removable(current_actor_context): ++ """Without RHUIInfo, unsigned packages should not be removable (baseline behavior).""" ++ unsigned_rpm = _make_rpm('some-unsigned-pkg', packager=UNSIGNED_PACKAGER) ++ signed_rpm = _make_rpm('sample01') ++ ++ current_actor_context.feed(DistributionSignedRPM(items=[signed_rpm])) ++ current_actor_context.feed(InstalledRPM(items=[unsigned_rpm, signed_rpm])) ++ current_actor_context.feed(RpmTransactionTasks(to_remove=['some-unsigned-pkg'])) ++ current_actor_context.run() ++ ++ result = current_actor_context.consume(FilteredRpmTransactionTasks) ++ assert len(result) == 1 ++ assert 'some-unsigned-pkg' not in result[0].to_remove ++ ++ ++def test_rhui_multiple_source_clients(current_actor_context): ++ """Multiple RHUI source clients should all be treated as signed when installed.""" ++ client_rpms = [ ++ _make_rpm('rhui-client-a', packager=UNSIGNED_PACKAGER), ++ _make_rpm('rhui-client-b', packager=UNSIGNED_PACKAGER), ++ ] ++ ++ current_actor_context.feed(DistributionSignedRPM(items=[])) ++ current_actor_context.feed(InstalledRPM(items=client_rpms)) ++ current_actor_context.feed(_make_rhui_info(['rhui-client-a', 'rhui-client-b'], ['rhui-client-target'])) ++ current_actor_context.feed(RpmTransactionTasks( ++ to_remove=['rhui-client-a', 'rhui-client-b'], ++ )) ++ current_actor_context.run() ++ ++ result = current_actor_context.consume(FilteredRpmTransactionTasks) ++ assert len(result) == 1 ++ assert 'rhui-client-a' in result[0].to_remove ++ assert 'rhui-client-b' in result[0].to_remove ++ ++ ++def test_rhui_source_client_ends_up_in_upgrade_if_not_removed(current_actor_context): ++ """An installed RHUI source client not in to_remove/to_install should be upgraded.""" ++ rhui_client_rpm = _make_rpm('rhui-azure-rhel8', packager=UNSIGNED_PACKAGER) ++ ++ current_actor_context.feed(DistributionSignedRPM(items=[])) ++ current_actor_context.feed(InstalledRPM(items=[rhui_client_rpm])) ++ current_actor_context.feed(_make_rhui_info(['rhui-azure-rhel8'], ['rhui-azure-rhel9'])) ++ current_actor_context.feed(RpmTransactionTasks()) ++ current_actor_context.run() ++ ++ result = current_actor_context.consume(FilteredRpmTransactionTasks) ++ assert len(result) == 1 ++ assert 'rhui-azure-rhel8' in result[0].to_upgrade +-- +2.53.0 + diff --git a/0039-Ensure-that-greenboot-rpms-are-removed-during-IPU.patch b/0039-Ensure-that-greenboot-rpms-are-removed-during-IPU.patch new file mode 100644 index 0000000..ac85e1c --- /dev/null +++ b/0039-Ensure-that-greenboot-rpms-are-removed-during-IPU.patch @@ -0,0 +1,42 @@ +From f11f7c4c022b990f3cad15eff5149591e747a27b Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Thu, 2 Apr 2026 10:57:55 +0200 +Subject: [PATCH 39/44] Ensure that greenboot rpms are removed during IPU + +The greenboot packages have a value just for rpm-ostree based systems. +However, if someone install them anyway (e.g. configuration mistake..), +they would damage the upgraded systems - mainly in case IPU 8.10 -> 9.8+. +Systemd fails with error: + ``` + Failed to isolate the default target. + ``` + +Due to bugs in greenboot scriptlets, that do not count with DNF +execution inside container, nor with the update of greenboot packages +from 0.14.x to 0.16.x and newer. + +As there is not value to have these packages on rpm based system +at all, just remove them during the upgrade to stay on a safe side. +--- + etc/leapp/transaction/to_remove | 8 ++++++++ + 1 file changed, 8 insertions(+) + +diff --git a/etc/leapp/transaction/to_remove b/etc/leapp/transaction/to_remove +index 0feb7827..420078f4 100644 +--- a/etc/leapp/transaction/to_remove ++++ b/etc/leapp/transaction/to_remove +@@ -1,3 +1,11 @@ + ### List of packages (each on new line) to be removed from the upgrade transaction + # Removing initial-setup package to avoid it asking for EULA acceptance during upgrade - OAMG-1531 + initial-setup ++ ++# greenboot packages have a value just for rpm-ostree based systems ++# however, if someone would install them anyway, they would damage ++# the upgraded systems (mainly in case IPU 8.10 -> 9.8+). ++# As there is not value for of these packages on systems upgraded by leapp ++# (rpm based only), let's just remove them to stay safe ++greenboot ++greenboot-default-health-checks +-- +2.53.0 + diff --git a/0040-Regenerate-grub-config-during-8-9-conversions.patch b/0040-Regenerate-grub-config-during-8-9-conversions.patch new file mode 100644 index 0000000..44b7d25 --- /dev/null +++ b/0040-Regenerate-grub-config-during-8-9-conversions.patch @@ -0,0 +1,205 @@ +From 83540ae7dbd6cb030a024249d6308c56f0d3216d Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Tue, 31 Mar 2026 17:23:39 +0200 +Subject: [PATCH 40/44] Regenerate grub config during 8->9 conversions + +This is mainly a preventative action to make sure that the grub config +is compatible with the target grub. + +The actor only runs grub2-mkconfig when BLS is enabled in +/etc/default/grub. When BLS is disabled, the regeneration is taken care +of by the grub kernel install scripts (in /usr/lib/kernel/install/), +which do call grub2-mkconfig as required. + +On 9to10 conversions the kernel install scripts handle regeneration +whether the BLS is enabled or not. + +Note that in some cases grub2-mkconfig might be ran twice, as there are +2 more actors that run it (ensurevalidgrubcfghybrid and +grub2mkconfigonppc64). This shouldn't be a problem since the generation +is quick. However a better solution could be designed in the future. + +Jira: RHEL-110712 +--- + .../actors/regenerategrubcfg/actor.py | 23 ++++ + .../libraries/regenerategrubcfg.py | 28 +++++ + .../tests/test_regenerategrubcfg.py | 102 ++++++++++++++++++ + 3 files changed, 153 insertions(+) + create mode 100644 repos/system_upgrade/el8toel9/actors/regenerategrubcfg/actor.py + create mode 100644 repos/system_upgrade/el8toel9/actors/regenerategrubcfg/libraries/regenerategrubcfg.py + create mode 100644 repos/system_upgrade/el8toel9/actors/regenerategrubcfg/tests/test_regenerategrubcfg.py + +diff --git a/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/actor.py b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/actor.py +new file mode 100644 +index 00000000..d87e9c7b +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/actor.py +@@ -0,0 +1,23 @@ ++from leapp.actors import Actor ++from leapp.libraries.actor import regenerategrubcfg ++from leapp.models import DefaultGrubInfo, TransactionCompleted ++from leapp.tags import ApplicationsPhaseTag, IPUWorkflowTag ++ ++ ++class RegenerateGrubCfg(Actor): ++ """ ++ Regenerate GRUB2 configuration during conversion from EL8 to EL9. ++ ++ During distribution conversions (e.g. CentOS to RHEL), the GRUB2 ++ configuration may need to be regenerated to ensure compatibility ++ with the target distribution's GRUB2 tooling. This actor runs ++ grub2-mkconfig when BLS is enabled in /etc/default/grub. ++ """ ++ ++ name = 'regenerate_grub_cfg' ++ consumes = (DefaultGrubInfo, TransactionCompleted) ++ produces = () ++ tags = (IPUWorkflowTag, ApplicationsPhaseTag) ++ ++ def process(self): ++ regenerategrubcfg.process() +diff --git a/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/libraries/regenerategrubcfg.py b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/libraries/regenerategrubcfg.py +new file mode 100644 +index 00000000..bedd0897 +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/libraries/regenerategrubcfg.py +@@ -0,0 +1,28 @@ ++from leapp.libraries.common import grub ++from leapp.libraries.common.config import architecture, is_conversion ++from leapp.libraries.stdlib import api, CalledProcessError, run ++from leapp.models import DefaultGrubInfo ++ ++GRUB_CFG_PATH = '/boot/grub2/grub.cfg' ++ ++ ++def process(): ++ if architecture.matches_architecture(architecture.ARCH_S390X): ++ return ++ ++ if not is_conversion(): ++ return ++ ++ default_grub_msg = next(api.consume(DefaultGrubInfo), None) ++ if not default_grub_msg: ++ api.current_logger().warning('No DefaultGrubInfo message, skipping GRUB config regeneration.') ++ return ++ ++ if not grub.is_blscfg_enabled_in_defaultgrub(default_grub_msg): ++ return ++ ++ api.current_logger().info('Conversion detected with BLS enabled, regenerating GRUB config') ++ try: ++ run(['grub2-mkconfig', '-o', GRUB_CFG_PATH]) ++ except CalledProcessError as e: ++ api.current_logger().error('Failed to regenerate GRUB config: {}'.format(e)) +diff --git a/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/tests/test_regenerategrubcfg.py b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/tests/test_regenerategrubcfg.py +new file mode 100644 +index 00000000..7d8fb6f3 +--- /dev/null ++++ b/repos/system_upgrade/el8toel9/actors/regenerategrubcfg/tests/test_regenerategrubcfg.py +@@ -0,0 +1,102 @@ ++from unittest import mock ++ ++import pytest ++ ++from leapp.libraries.actor import regenerategrubcfg ++from leapp.libraries.common.config import architecture ++from leapp.libraries.common.testutils import CurrentActorMocked, logger_mocked ++from leapp.libraries.stdlib import api, CalledProcessError ++from leapp.models import DefaultGrub, DefaultGrubInfo ++ ++GRUB2_MKCONFIG_CMD = ['grub2-mkconfig', '-o', '/boot/grub2/grub.cfg'] ++ ++BLS_ENABLED = DefaultGrubInfo( ++ default_grub_info=[DefaultGrub(name='GRUB_ENABLE_BLSCFG', value='true')] ++) ++BLS_DISABLED = DefaultGrubInfo( ++ default_grub_info=[DefaultGrub(name='GRUB_ENABLE_BLSCFG', value='false')] ++) ++ ++ ++@pytest.fixture ++def mocked_run(): ++ with mock.patch.object(regenerategrubcfg, 'run') as m: ++ yield m ++ ++ ++@pytest.fixture(autouse=True) ++def mocked_logger(): ++ with mock.patch.object(api, 'current_logger', logger_mocked()): ++ yield api.current_logger ++ ++ ++@pytest.fixture ++def mock_actor(monkeypatch): ++ ++ def make_mock(msgs, arch=architecture.ARCH_X86_64, is_conversion=False): ++ instance = CurrentActorMocked( ++ msgs=msgs, ++ arch=arch, ++ src_ver="8.10", ++ dst_ver="9.6", ++ ) ++ monkeypatch.setattr(api, 'current_actor', instance) ++ # let's use this to cover all conversion paths ++ monkeypatch.setattr(regenerategrubcfg, 'is_conversion', lambda: is_conversion) ++ return instance ++ ++ return make_mock ++ ++ ++def test_conversion_bls_enabled_regenerates(mock_actor, mocked_run): ++ """Conversion with BLS enabled -> regenerate.""" ++ mock_actor([BLS_ENABLED], is_conversion=True) ++ regenerategrubcfg.process() ++ mocked_run.assert_called_once_with(GRUB2_MKCONFIG_CMD) ++ ++ ++def test_conversion_bls_disabled_skips(mock_actor, mocked_run): ++ """Conversion with BLS not enabled -> skip.""" ++ mock_actor([BLS_DISABLED], is_conversion=True) ++ regenerategrubcfg.process() ++ mocked_run.assert_not_called() ++ ++ ++def test_non_conversion_skips(mock_actor, mocked_run): ++ """Non-conversion upgrade -> skip.""" ++ mock_actor([BLS_ENABLED]) ++ regenerategrubcfg.process() ++ mocked_run.assert_not_called() ++ ++ ++def test_s390x_skips(mock_actor, mocked_run): ++ """s390x -> skip (uses ZIPL).""" ++ mock_actor([BLS_ENABLED], arch=architecture.ARCH_S390X) ++ regenerategrubcfg.process() ++ mocked_run.assert_not_called() ++ ++ ++def test_no_default_grub_info_skips(mock_actor, mocked_run, mocked_logger): ++ """No DefaultGrubInfo -> skip.""" ++ mock_actor([], is_conversion=True) ++ regenerategrubcfg.process() ++ mocked_run.assert_not_called() ++ assert any( ++ "No DefaultGrubInfo message, skipping GRUB config regeneration." in msg ++ for msg in mocked_logger.warnmsg ++ ) ++ ++ ++def test_failure_nonfatal(mock_actor, mocked_run, mocked_logger): ++ """grub2-mkconfig failure -> non-fatal, logs error.""" ++ mocked_run.side_effect = CalledProcessError( ++ message='A Leapp Command Error occurred.', ++ command=GRUB2_MKCONFIG_CMD, ++ result={'signal': None, 'exit_code': 1, 'pid': 0, 'stdout': 'fake', 'stderr': 'fake'} ++ ) ++ mock_actor([BLS_ENABLED], is_conversion=True) ++ ++ regenerategrubcfg.process() ++ ++ mocked_run.assert_called_once_with(GRUB2_MKCONFIG_CMD) ++ assert any('Failed to regenerate GRUB config' in msg for msg in mocked_logger.errmsg) +-- +2.53.0 + diff --git a/0041-python-tests-deps-update-version-requirements-per-py.patch b/0041-python-tests-deps-update-version-requirements-per-py.patch new file mode 100644 index 0000000..2c4fe24 --- /dev/null +++ b/0041-python-tests-deps-update-version-requirements-per-py.patch @@ -0,0 +1,75 @@ +From 971e5e329290d8e5047ac85c6c85943dfadd5fe6 Mon Sep 17 00:00:00 2001 +From: Petr Stodulka +Date: Tue, 14 Apr 2026 11:25:01 +0200 +Subject: [PATCH 41/44] python tests deps: update version requirements per + python + +tl;dr; We haven't updated the requirements.txt file for a long time +(basically since IPU 7 -> 8; if we do not count some minor updates). +Let's update dependencies to use newer python modules for newer +versions of python. + +* Pytest + Originally we required pytest v6.2.5 for any python 3.6+. This is + pretty old requirement coming from time of python ~ 3.8 and recently + a CVE-2025-71176 occuared, which is fix in pytest v9.0.3. + So let's update ranges to actually allow use of newer pytest on newer + systems: + + +----------------+---------------+ + | pytest version | python range | + +----------------+---------------+ + | 6.2.5 | 3.6.x - 3.7.x | + | 7.4.4 | 3.8.x - 3.9.x | + | 9.0.3 | 3.10+ | + +----------------+---------------+ + Note that Pytest 8.x is messing with imports which breaks leapp + import handling unfortunately (race-condition). Seems that these + problems are fixed for Pytest 9 with Python 3.10+. In case we + figure out problems anyway, pytest will need to be executed with + additional parameters to use old import style again. As there is + no high demand for newer pytest on python 3.9, let's stick just + with working pytest versions. + +* Pyudev + The original v0.22 is used up to CS 9 (pyton 3.9-). Use 0.24.1 for + python 3.10+ (reflects CS 10 as well) + +* Distro + The original v1.5.0 can be used till CS 9 (python 3.9 included) safely + as nowadays. Let's use version 1.9.0 for Python 3.10+ + +* Drop unsued dependencies (old python that is no longer supported + in the project). +--- + requirements.txt | 13 +++++++------ + 1 file changed, 7 insertions(+), 6 deletions(-) + +diff --git a/requirements.txt b/requirements.txt +index 3c79b23d..e4294718 100644 +--- a/requirements.txt ++++ b/requirements.txt +@@ -5,13 +5,14 @@ isort + funcsigs==1.0.2 + mock==2.0.0 + pylint +-pytest==4.6.11; python_version < '3.0' +-pytest==6.2.5; python_version >= '3.6' +-pyudev==0.22.0 +-distro==1.5.0 ++pytest==6.2.5; python_version >= '3.6' and python_version < '3.8' ++pytest==7.4.4; python_version >= '3.8' and python_version < '3.10' ++pytest==9.0.3; python_version >= '3.10' ++pyudev==0.22.0; python_version < '3.10' ++pyudev==0.24.1; python_version >= '3.10' ++distro==1.5.0; python_version < '3.10' ++distro==1.9.0; python_version >= '3.10' + ipaddress==1.0.23 + git+https://github.com/oamg/leapp + requests +-# pinning a py27 troublemaking transitive dependency +-lazy-object-proxy==1.5.2; python_version < '3' + rpm +-- +2.53.0 + diff --git a/0042-Drop-dependency-on-mock.patch b/0042-Drop-dependency-on-mock.patch new file mode 100644 index 0000000..0108063 --- /dev/null +++ b/0042-Drop-dependency-on-mock.patch @@ -0,0 +1,149 @@ +From 0f0be8e4ca80721173d289a3db0b170334529c2c Mon Sep 17 00:00:00 2001 +From: Matej Matuska +Date: Wed, 29 Oct 2025 19:31:00 +0100 +Subject: [PATCH 42/44] Drop dependency on mock + +The mock library is now a part of the Python standard library since +Python 3.3 and is available as the unittest.mock. The 'mock' library is +only a backport which is not needed anymore. + +Also remove some unnecessary imports. +--- + commands/tests/test_upgrade_paths.py | 2 +- + .../common/actors/biosdevname/tests/test_biosdevname.py | 3 ++- + .../actors/cephvolumescan/tests/test_cephvolumescan.py | 5 +---- + .../tests/test_distributionsignedrpmscanner.py | 3 +-- + .../actors/ifcfgscanner/tests/unit_test_ifcfgscanner.py | 2 +- + .../common/actors/scanmemory/tests/test_scanmemory.py | 3 ++- + .../tests/component_test_selinuxcontentscanner.py | 4 +--- + .../el8toel9/actors/nisscanner/tests/test_nisscan.py | 3 ++- + requirements.txt | 1 - + 9 files changed, 11 insertions(+), 15 deletions(-) + +diff --git a/commands/tests/test_upgrade_paths.py b/commands/tests/test_upgrade_paths.py +index 773cdf1c..83e8b7f9 100644 +--- a/commands/tests/test_upgrade_paths.py ++++ b/commands/tests/test_upgrade_paths.py +@@ -1,7 +1,7 @@ + import os + import resource ++import unittest.mock as mock + +-import mock + import pytest + + from leapp.cli.commands import command_utils +diff --git a/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py b/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py +index 3aa8c614..1b11174f 100644 +--- a/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py ++++ b/repos/system_upgrade/common/actors/biosdevname/tests/test_biosdevname.py +@@ -1,7 +1,8 @@ ++from unittest.mock import mock_open, patch ++ + import pytest + import pyudev + import six +-from mock import mock_open, patch + + from leapp.exceptions import StopActorExecutionError + from leapp.libraries.actor import biosdevname +diff --git a/repos/system_upgrade/common/actors/cephvolumescan/tests/test_cephvolumescan.py b/repos/system_upgrade/common/actors/cephvolumescan/tests/test_cephvolumescan.py +index 168b8fc2..14e1f359 100644 +--- a/repos/system_upgrade/common/actors/cephvolumescan/tests/test_cephvolumescan.py ++++ b/repos/system_upgrade/common/actors/cephvolumescan/tests/test_cephvolumescan.py +@@ -1,9 +1,6 @@ +-import pytest +-from mock import Mock, patch ++from unittest.mock import patch + + from leapp.libraries.actor import cephvolumescan +-from leapp.models import InstalledRPM, LsblkEntry, RPM, StorageInfo +-from leapp.reporting import Report + + CONT_PS_COMMAND_OUTPUT = { + "stdout": +diff --git a/repos/system_upgrade/common/actors/distributionsignedrpmscanner/tests/test_distributionsignedrpmscanner.py b/repos/system_upgrade/common/actors/distributionsignedrpmscanner/tests/test_distributionsignedrpmscanner.py +index b0c616cb..e5db0c8f 100644 +--- a/repos/system_upgrade/common/actors/distributionsignedrpmscanner/tests/test_distributionsignedrpmscanner.py ++++ b/repos/system_upgrade/common/actors/distributionsignedrpmscanner/tests/test_distributionsignedrpmscanner.py +@@ -1,4 +1,4 @@ +-import mock ++import unittest.mock as mock + + from leapp.libraries.common import rpms + from leapp.libraries.common.config import mock_configs +@@ -8,7 +8,6 @@ from leapp.models import ( + fields, + InstalledRPM, + InstalledUnsignedRPM, +- IPUConfig, + Model, + OSRelease, + RPM, +diff --git a/repos/system_upgrade/common/actors/ifcfgscanner/tests/unit_test_ifcfgscanner.py b/repos/system_upgrade/common/actors/ifcfgscanner/tests/unit_test_ifcfgscanner.py +index d996de84..bef3d485 100644 +--- a/repos/system_upgrade/common/actors/ifcfgscanner/tests/unit_test_ifcfgscanner.py ++++ b/repos/system_upgrade/common/actors/ifcfgscanner/tests/unit_test_ifcfgscanner.py +@@ -1,9 +1,9 @@ + import errno + import textwrap ++import unittest.mock as mock + from io import StringIO + from os.path import basename + +-import mock + import six + + from leapp.libraries.actor import ifcfgscanner +diff --git a/repos/system_upgrade/common/actors/scanmemory/tests/test_scanmemory.py b/repos/system_upgrade/common/actors/scanmemory/tests/test_scanmemory.py +index 13e4e724..20fa8e91 100644 +--- a/repos/system_upgrade/common/actors/scanmemory/tests/test_scanmemory.py ++++ b/repos/system_upgrade/common/actors/scanmemory/tests/test_scanmemory.py +@@ -1,4 +1,5 @@ +-import mock ++import unittest.mock as mock ++ + import six + + from leapp.libraries.actor import scanmemory +diff --git a/repos/system_upgrade/common/actors/selinux/selinuxcontentscanner/tests/component_test_selinuxcontentscanner.py b/repos/system_upgrade/common/actors/selinux/selinuxcontentscanner/tests/component_test_selinuxcontentscanner.py +index 802e038a..15aef5d8 100644 +--- a/repos/system_upgrade/common/actors/selinux/selinuxcontentscanner/tests/component_test_selinuxcontentscanner.py ++++ b/repos/system_upgrade/common/actors/selinux/selinuxcontentscanner/tests/component_test_selinuxcontentscanner.py +@@ -4,9 +4,7 @@ import pytest + + from leapp.libraries.common.config import mock_configs + from leapp.libraries.stdlib import api, CalledProcessError, run +-from leapp.models import SELinuxCustom, SELinuxFacts, SELinuxModule, SELinuxModules, SELinuxRequestRPMs +-from leapp.reporting import Report +-from leapp.snactor.fixture import current_actor_context ++from leapp.models import SELinuxCustom, SELinuxFacts, SELinuxModules, SELinuxRequestRPMs + + # compat module ensures compatibility with newer systems and is not part of testing + TEST_MODULES = [ +diff --git a/repos/system_upgrade/el8toel9/actors/nisscanner/tests/test_nisscan.py b/repos/system_upgrade/el8toel9/actors/nisscanner/tests/test_nisscan.py +index ed000ce0..d7e77a28 100644 +--- a/repos/system_upgrade/el8toel9/actors/nisscanner/tests/test_nisscan.py ++++ b/repos/system_upgrade/el8toel9/actors/nisscanner/tests/test_nisscan.py +@@ -1,4 +1,5 @@ +-import mock ++import unittest.mock as mock ++ + import pytest + import six + +diff --git a/requirements.txt b/requirements.txt +index e4294718..ee1d9006 100644 +--- a/requirements.txt ++++ b/requirements.txt +@@ -3,7 +3,6 @@ + flake8 + isort + funcsigs==1.0.2 +-mock==2.0.0 + pylint + pytest==6.2.5; python_version >= '3.6' and python_version < '3.8' + pytest==7.4.4; python_version >= '3.8' and python_version < '3.10' +-- +2.53.0 + diff --git a/0043-remove-single-quoting-from-remediation-commands-1520.patch b/0043-remove-single-quoting-from-remediation-commands-1520.patch new file mode 100644 index 0000000..6a38567 --- /dev/null +++ b/0043-remove-single-quoting-from-remediation-commands-1520.patch @@ -0,0 +1,194 @@ +From d8c82c9460e2ab08ac735c7af06ec4a73a9b4de4 Mon Sep 17 00:00:00 2001 +From: =?UTF-8?q?Peter=20Mo=C4=8D=C3=A1ry?= + <68905580+PeterMocary@users.noreply.github.com> +Date: Thu, 16 Apr 2026 23:00:14 +0200 +Subject: [PATCH 43/44] remove single quoting from remediation commands (#1520) + +The framework now uses shlex.quote to always make literals out of +remediation command arguments. Some of the existing remediation commands used single +quotes in their subcommands so the resulting command in leapp-report.txt used +unintuitive escaping of single quotes. + +The chackrootsymlinks can still end up with a single quote if the user +has it in one of the symlinks that need to be adjusted. However, it is +not possible to handle this differently without introducing side effects. + +jira: RHEL-156521 +--- + packaging/leapp-repository.spec | 2 +- + .../common/actors/checkrootsymlinks/actor.py | 53 +-------------- + .../libraries/checkrootsymlinks.py | 65 +++++++++++++++++++ + .../libraries/checkyumpluginsenabled.py | 6 +- + 4 files changed, 71 insertions(+), 55 deletions(-) + create mode 100644 repos/system_upgrade/common/actors/checkrootsymlinks/libraries/checkrootsymlinks.py + +diff --git a/packaging/leapp-repository.spec b/packaging/leapp-repository.spec +index 3ffafafa..70b1d7d3 100644 +--- a/packaging/leapp-repository.spec ++++ b/packaging/leapp-repository.spec +@@ -120,7 +120,7 @@ Requires: leapp-repository-dependencies = %{leapp_repo_deps} + + # IMPORTANT: this is capability provided by the leapp framework rpm. + # Check that 'version' instead of the real framework rpm version. +-Requires: leapp-framework >= 6.4, leapp-framework < 7 ++Requires: leapp-framework >= 6.5, leapp-framework < 7 + + # Since we provide sub-commands for the leapp utility, we expect the leapp + # tool to be installed as well. +diff --git a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +index 2e805542..391e5589 100644 +--- a/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py ++++ b/repos/system_upgrade/common/actors/checkrootsymlinks/actor.py +@@ -1,8 +1,5 @@ +-import os +- +-from leapp import reporting + from leapp.actors import Actor +-from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.actor import checkrootsymlinks + from leapp.models import Report, RootDirectory + from leapp.tags import ChecksPhaseTag, IPUWorkflowTag + +@@ -20,50 +17,4 @@ class CheckRootSymlinks(Actor): + tags = (IPUWorkflowTag, ChecksPhaseTag) + + def process(self): +- rootdir = next(self.consume(RootDirectory), None) +- if not rootdir: +- raise StopActorExecutionError('Cannot check root symlinks', +- details={'Problem': 'Did not receive a message with ' +- 'root subdirectories'}) +- absolute_links = [item for item in rootdir.items if item.target and os.path.isabs(item.target)] +- absolute_links_nonutf = [item for item in rootdir.invalid_items if item.target and os.path.isabs(item.target)] +- if not absolute_links and not absolute_links_nonutf: +- return +- +- report_fields = [ +- reporting.Title('Upgrade requires links in root directory to be relative'), +- reporting.Summary( +- 'After rebooting, parts of the upgrade process can fail if symbolic links in / ' +- 'point to absolute paths.\n' +- 'Please change these links to relative ones.' +- ), +- reporting.ExternalLink( +- url='https://access.redhat.com/solutions/6989732', +- title='leapp upgrade stops with Inhibitor "Upgrade requires links in root ' +- 'directory to be relative"' +- ), +- reporting.Severity(reporting.Severity.HIGH), +- reporting.Groups([reporting.Groups.INHIBITOR])] +- +- # Generate reports about absolute links presence +- rem_commands = [] +- if absolute_links: +- commands = [] +- for item in absolute_links: +- command = ' '.join(['ln', +- '-snf', +- f"'{os.path.relpath(item.target, '/')}'", +- f"'{os.path.join('/', item.name)}'"]) +- commands.append(command) +- rem_commands = [['bash', '-c', '{}'.format(' && '.join(commands))]] +- # Generate reports about non-utf8 absolute links presence +- nonutf_count = len(absolute_links_nonutf) +- if nonutf_count > 0: +- # for non-utf encoded filenames can't provide a remediation command, so will mention this fact in a hint +- rem_hint = ("{} symbolic links point to absolute paths that have non-utf8 encoding and need to be" +- " fixed additionally".format(nonutf_count)) +- report_fields.append(reporting.Remediation(hint=rem_hint, commands=rem_commands)) +- else: +- report_fields.append(reporting.Remediation(commands=rem_commands)) +- +- reporting.create_report(report_fields) ++ checkrootsymlinks.process() +diff --git a/repos/system_upgrade/common/actors/checkrootsymlinks/libraries/checkrootsymlinks.py b/repos/system_upgrade/common/actors/checkrootsymlinks/libraries/checkrootsymlinks.py +new file mode 100644 +index 00000000..2c5676bd +--- /dev/null ++++ b/repos/system_upgrade/common/actors/checkrootsymlinks/libraries/checkrootsymlinks.py +@@ -0,0 +1,65 @@ ++import os ++ ++from leapp import reporting ++from leapp.exceptions import StopActorExecutionError ++from leapp.libraries.stdlib import api ++from leapp.models import RootDirectory ++ ++ ++def _dquote(s): ++ """Double-quote a string for use inside a non-interactive shell script.""" ++ escaped = (s.replace('\\', '\\\\') ++ .replace('"', '\\"') ++ .replace('$', '\\$') ++ .replace('`', '\\`')) ++ return '"{}"'.format(escaped) ++ ++ ++def process(): ++ rootdir = next(api.consume(RootDirectory), None) ++ if not rootdir: ++ raise StopActorExecutionError('Cannot check root symlinks', ++ details={'Problem': 'Did not receive a message with ' ++ 'root subdirectories'}) ++ absolute_links = [item for item in rootdir.items if item.target and os.path.isabs(item.target)] ++ absolute_links_nonutf = [item for item in rootdir.invalid_items if item.target and os.path.isabs(item.target)] ++ if not absolute_links and not absolute_links_nonutf: ++ return ++ ++ report_fields = [ ++ reporting.Title('Upgrade requires links in root directory to be relative'), ++ reporting.Summary( ++ 'After rebooting, parts of the upgrade process can fail if symbolic links in / ' ++ 'point to absolute paths.\n' ++ 'Please change these links to relative ones.' ++ ), ++ reporting.ExternalLink( ++ url='https://access.redhat.com/solutions/6989732', ++ title='leapp upgrade stops with Inhibitor "Upgrade requires links in root ' ++ 'directory to be relative"' ++ ), ++ reporting.Severity(reporting.Severity.HIGH), ++ reporting.Groups([reporting.Groups.INHIBITOR])] ++ ++ # Generate reports about absolute links presence ++ rem_commands = [] ++ if absolute_links: ++ commands = [] ++ for item in absolute_links: ++ command = ' '.join(['ln', ++ '-snf', ++ _dquote(os.path.relpath(item.target, '/')), ++ _dquote(os.path.join('/', item.name))]) ++ commands.append(command) ++ rem_commands = [['bash', '-c', '{}'.format(' && '.join(commands))]] ++ # Generate reports about non-utf8 absolute links presence ++ nonutf_count = len(absolute_links_nonutf) ++ if nonutf_count > 0: ++ # for non-utf encoded filenames can't provide a remediation command, so will mention this fact in a hint ++ rem_hint = ("{} symbolic links point to absolute paths that have non-utf8 encoding and need to be" ++ " fixed additionally".format(nonutf_count)) ++ report_fields.append(reporting.Remediation(hint=rem_hint, commands=rem_commands)) ++ else: ++ report_fields.append(reporting.Remediation(commands=rem_commands)) ++ ++ reporting.create_report(report_fields) +diff --git a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +index 869e2a88..5c99a0d9 100644 +--- a/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py ++++ b/repos/system_upgrade/common/actors/checkyumpluginsenabled/libraries/checkyumpluginsenabled.py +@@ -36,9 +36,9 @@ def check_required_dnf_plugins_enabled(pkg_manager_info): + product_id_plugin_conf = os.path.join(plugin_configs_dir, 'product-id.conf') + + remediation_commands = [ +- f"sed -i 's/^plugins=0/plugins=1/' '{dnf_conf_path}'", +- f"sed -i 's/^enabled=0/enabled=1/' '{rhsm_plugin_conf}'", +- f"sed -i 's/^enabled=0/enabled=1/' '{product_id_plugin_conf}'" ++ f'sed -i "s/^plugins=0/plugins=1/" "{dnf_conf_path}"', ++ f'sed -i "s/^enabled=0/enabled=1/" "{rhsm_plugin_conf}"', ++ f'sed -i "s/^enabled=0/enabled=1/" "{product_id_plugin_conf}"', + ] + + reporting.create_report([ +-- +2.53.0 + diff --git a/0044-Update-leapp-data-data-stream-4.3-CTC-1.patch b/0044-Update-leapp-data-data-stream-4.3-CTC-1.patch new file mode 100644 index 0000000..83e584b --- /dev/null +++ b/0044-Update-leapp-data-data-stream-4.3-CTC-1.patch @@ -0,0 +1,4401 @@ +From a86bee719a998d629efd7b7be1bf2ff08ee43234 Mon Sep 17 00:00:00 2001 +From: Leapp CI Bot +Date: Mon, 16 Feb 2026 03:12:49 +0000 +Subject: [PATCH 44/44] Update leapp data: data stream 4.3: CTC 1 + +* repomap: add GCP RHUI repos + EUS for RT/NFV + The following mappings for UpgPath(src_major='9', dst_major='10') have been added: + - MappingEntry(src='rhel9-rhui-google-compute-engine', dst=('rhel10-rhui-google-compute-engine-leapp',)) + + The following repos have been added: + - Repo(pesid='rhel10-AppStream', major_version='10', repoid='rhui-rhel-10-for-x86_64-appstream-e4s-rhui-rpms', repo_type='rpm', channel='e4s', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-AppStream', major_version='10', repoid='rhui-rhel-10-for-x86_64-appstream-rhui-rpms', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-BaseOS', major_version='10', repoid='rhui-rhel-10-for-x86_64-baseos-e4s-rhui-rpms', repo_type='rpm', channel='e4s', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-BaseOS', major_version='10', repoid='rhui-rhel-10-for-x86_64-baseos-rhui-rpms', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-CRB', major_version='10', repoid='rhui-codeready-builder-for-rhel-10-x86_64-rhui-rpms', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-HighAvailability', major_version='10', repoid='rhui-rhel-10-for-x86_64-highavailability-e4s-rhui-rpms', repo_type='rpm', channel='e4s', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-NFV', major_version='10', repoid='rhel-10-for-aarch64-nfv-eus-rpms', repo_type='rpm', channel='eus', arch='aarch64', rhui=None, distro='rhel') + - Repo(pesid='rhel10-NFV', major_version='10', repoid='rhel-10-for-ppc64le-nfv-beta-rpms', repo_type='rpm', channel='beta', arch='ppc64le', rhui=None, distro='rhel') + - Repo(pesid='rhel10-NFV', major_version='10', repoid='rhel-10-for-s390x-nfv-beta-rpms', repo_type='rpm', channel='beta', arch='s390x', rhui=None, distro='rhel') + - Repo(pesid='rhel10-NFV', major_version='10', repoid='rhel-10-for-x86_64-nfv-eus-rpms', repo_type='rpm', channel='eus', arch='x86_64', rhui=None, distro='rhel') + - Repo(pesid='rhel10-RT', major_version='10', repoid='rhel-10-for-aarch64-rt-eus-rpms', repo_type='rpm', channel='eus', arch='aarch64', rhui=None, distro='rhel') + - Repo(pesid='rhel10-RT', major_version='10', repoid='rhel-10-for-ppc64le-rt-beta-rpms', repo_type='rpm', channel='beta', arch='ppc64le', rhui=None, distro='rhel') + - Repo(pesid='rhel10-RT', major_version='10', repoid='rhel-10-for-s390x-rt-beta-rpms', repo_type='rpm', channel='beta', arch='s390x', rhui=None, distro='rhel') + - Repo(pesid='rhel10-RT', major_version='10', repoid='rhel-10-for-x86_64-rt-eus-rpms', repo_type='rpm', channel='eus', arch='x86_64', rhui=None, distro='rhel') + - Repo(pesid='rhel10-SAP-NetWeaver', major_version='10', repoid='rhel-10-for-aarch64-sap-netweaver-beta-rpms', repo_type='rpm', channel='beta', arch='aarch64', rhui=None, distro='rhel') + - Repo(pesid='rhel10-SAP-NetWeaver', major_version='10', repoid='rhui-rhel-10-for-x86_64-sap-netweaver-e4s-rhui-rpms', repo_type='rpm', channel='e4s', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-SAP-Solutions', major_version='10', repoid='rhui-rhel-10-for-x86_64-sap-solutions-e4s-rhui-rpms', repo_type='rpm', channel='e4s', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-Supplementary', major_version='10', repoid='rhui-rhel-10-for-x86_64-supplementary-rhui-rpms', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-rhui-google-compute-engine', major_version='10', repoid='google-compute-engine', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel10-rhui-google-compute-engine-leapp', major_version='10', repoid='google-compute-engine-el10-for-x86_64', repo_type='rpm', channel='ga', arch='x86_64', rhui='google', distro='rhel') + - Repo(pesid='rhel9-NFV', major_version='9', repoid='rhel-9-for-aarch64-nfv-eus-rpms', repo_type='rpm', channel='eus', arch='aarch64', rhui=None, distro='rhel') + - Repo(pesid='rhel9-NFV', major_version='9', repoid='rhel-9-for-ppc64le-nfv-beta-rpms', repo_type='rpm', channel='beta', arch='ppc64le', rhui=None, distro='rhel') + - Repo(pesid='rhel9-NFV', major_version='9', repoid='rhel-9-for-s390x-nfv-beta-rpms', repo_type='rpm', channel='beta', arch='s390x', rhui=None, distro='rhel') + - Repo(pesid='rhel9-NFV', major_version='9', repoid='rhel-9-for-x86_64-nfv-eus-rpms', repo_type='rpm', channel='eus', arch='x86_64', rhui=None, distro='rhel') + - Repo(pesid='rhel9-RT', major_version='9', repoid='rhel-9-for-aarch64-rt-eus-rpms', repo_type='rpm', channel='eus', arch='aarch64', rhui=None, distro='rhel') + - Repo(pesid='rhel9-RT', major_version='9', repoid='rhel-9-for-ppc64le-rt-beta-rpms', repo_type='rpm', channel='beta', arch='ppc64le', rhui=None, distro='rhel') + - Repo(pesid='rhel9-RT', major_version='9', repoid='rhel-9-for-s390x-rt-beta-rpms', repo_type='rpm', channel='beta', arch='s390x', rhui=None, distro='rhel') + - Repo(pesid='rhel9-RT', major_version='9', repoid='rhel-9-for-x86_64-rt-eus-rpms', repo_type='rpm', channel='eus', arch='x86_64', rhui=None, distro='rhel') + - Repo(pesid='rhel9-SAP-NetWeaver', major_version='9', repoid='rhel-9-for-aarch64-sap-netweaver-beta-rpms', repo_type='rpm', channel='beta', arch='aarch64', rhui=None, distro='rhel') + +* DDDD: Add Emulex devices, update Mellanox for RHEL 10 + - Add 2 Emulex lpfc devices for RHEL 7 (LPe15000/LPe16000 VF, OneConnect FCoE VF) + - Update ConnectX-9 (0x1025): Now available and maintained in RHEL 10 + - Add ConnectX-10 (0x1027): New device entry (not yet available) + - Update BlueField-4 ConnectX-8 (0xA2DF): Now available and maintained in RHEL 10 + (DDDD summary generated with Claude Code Opus 4.6) + +* PES data: Reflect newest changes for RHEL 9.9 & 10.3 +--- + .../files/device_driver_deprecation_data.json | 51 +- + etc/leapp/files/pes-events.json | 2534 +++++++++++++++-- + etc/leapp/files/repomap.json | 263 +- + 3 files changed, 2539 insertions(+), 309 deletions(-) + +diff --git a/etc/leapp/files/device_driver_deprecation_data.json b/etc/leapp/files/device_driver_deprecation_data.json +index c38c2840..df35538f 100644 +--- a/etc/leapp/files/device_driver_deprecation_data.json ++++ b/etc/leapp/files/device_driver_deprecation_data.json +@@ -1,6 +1,6 @@ + { + "provided_data_streams": [ +- "4.2" ++ "4.3" + ], + "data": [ + { +@@ -4764,6 +4764,32 @@ + 8 + ] + }, ++ { ++ "available_in_rhel": [ ++ 7 ++ ], ++ "deprecation_announced": "", ++ "device_id": "0x10df:0xe208", ++ "device_name": "Emulex Corporation: LPe15000/LPe16000 Series 8Gb/16Gb Fibre Channel Adapter (VF)", ++ "device_type": "pci", ++ "driver_name": "lpfc", ++ "maintained_in_rhel": [ ++ 7 ++ ] ++ }, ++ { ++ "available_in_rhel": [ ++ 7 ++ ], ++ "deprecation_announced": "", ++ "device_id": "0x10df:0xe268", ++ "device_name": "Emulex Corporation: OneConnect FCoE Initiator (Lancer VF)", ++ "device_type": "pci", ++ "driver_name": "lpfc", ++ "maintained_in_rhel": [ ++ 7 ++ ] ++ }, + { + "available_in_rhel": [ + 7, +@@ -5316,12 +5342,25 @@ + ] + }, + { +- "available_in_rhel": [], ++ "available_in_rhel": [ ++ 10 ++ ], + "deprecation_announced": "", + "device_id": "0x15B3:0x1025", + "device_name": "ConnectX-9", + "device_type": "pci", + "driver_name": "mlx5", ++ "maintained_in_rhel": [ ++ 10 ++ ] ++ }, ++ { ++ "available_in_rhel": [], ++ "deprecation_announced": "", ++ "device_id": "0x15B3:0x1027", ++ "device_name": "ConnectX-10", ++ "device_type": "pci", ++ "driver_name": "mlx5", + "maintained_in_rhel": [] + }, + { +@@ -5343,13 +5382,17 @@ + ] + }, + { +- "available_in_rhel": [], ++ "available_in_rhel": [ ++ 10 ++ ], + "deprecation_announced": "", + "device_id": "0x15B3:0xA2DF", + "device_name": "BlueField-4 integrated ConnectX-8 network controller", + "device_type": "pci", + "driver_name": "mlx5", +- "maintained_in_rhel": [] ++ "maintained_in_rhel": [ ++ 10 ++ ] + }, + { + "available_in_rhel": [ +diff --git a/etc/leapp/files/pes-events.json b/etc/leapp/files/pes-events.json +index 07a716f0..33f64187 100644 +--- a/etc/leapp/files/pes-events.json ++++ b/etc/leapp/files/pes-events.json +@@ -1,7 +1,7 @@ + { +-"timestamp": "202602051305Z", ++"timestamp": "202603261505Z", + "provided_data_streams": [ +-"4.2" ++"4.3" + ], + "packageinfo": [ + { +@@ -541188,6 +541188,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby", +@@ -541198,13 +541202,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541255,6 +541266,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby-bundled-gems", +@@ -541265,13 +541280,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541322,6 +541344,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby-default-gems", +@@ -541332,13 +541358,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541389,6 +541422,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby-devel", +@@ -541399,13 +541436,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541456,6 +541500,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby-doc", +@@ -541466,13 +541514,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541523,6 +541578,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-bigdecimal", +@@ -541533,13 +541592,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541590,6 +541656,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-bundler", +@@ -541600,13 +541670,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541657,6 +541734,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-io-console", +@@ -541667,13 +541748,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541724,6 +541812,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-irb", +@@ -541734,13 +541826,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541791,6 +541890,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-json", +@@ -541801,13 +541904,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541858,6 +541968,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-minitest", +@@ -541868,13 +541982,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541925,6 +542046,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-power_assert", +@@ -541935,13 +542060,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -541992,6 +542124,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-psych", +@@ -542002,13 +542138,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542055,6 +542198,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-racc", +@@ -542065,13 +542212,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.3" + }, + "out_modulestream": null +@@ -542115,6 +542269,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-rake", +@@ -542125,13 +542283,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542182,6 +542347,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-rbs", +@@ -542192,13 +542361,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542249,6 +542425,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-rdoc", +@@ -542259,13 +542439,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542316,6 +542503,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-rexml", +@@ -542326,13 +542517,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542383,6 +542581,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-rss", +@@ -542393,13 +542595,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542450,6 +542659,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygems", +@@ -542460,13 +542673,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542517,6 +542737,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygems-devel", +@@ -542527,13 +542751,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542584,6 +542815,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-test-unit", +@@ -542594,13 +542829,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542651,6 +542893,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-typeprof", +@@ -542661,13 +542907,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -542718,6 +542971,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "ruby-libs", +@@ -542728,13 +542985,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -544792,6 +545056,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-pg", +@@ -544802,13 +545070,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -544859,6 +545134,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-mysql2", +@@ -544869,13 +545148,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -544926,6 +545212,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-pg-doc", +@@ -544936,13 +545226,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -544993,6 +545290,10 @@ null + { + "name": "ruby", + "stream": "3.3" ++}, ++{ ++"name": "ruby", ++"stream": "4.0" + } + ], + "name": "rubygem-mysql2-doc", +@@ -545003,13 +545304,20 @@ null + }, + "initial_release": { + "major_version": 9, +-"minor_version": 5, ++"minor_version": 9, + "os_name": "RHEL" + }, + "modulestream_maps": [ + { + "in_modulestream": { + "name": "ruby", ++"stream": "4.0" ++}, ++"out_modulestream": null ++}, ++{ ++"in_modulestream": { ++"name": "ruby", + "stream": "3.1" + }, + "out_modulestream": null +@@ -715291,29 +715599,1570 @@ null + "s390x", + "x86_64" + ], +-"id": 20115, ++"id": 20115, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "mariadb11.8-server-galera", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26817 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20116, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "mariadb11.8-server-utils", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26818 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20117, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "mariadb11.8-test", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26819 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20118, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26820 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20119, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-bcmath", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26821 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20120, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-cli", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26822 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20121, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-common", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26823 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20122, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-dba", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26824 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20123, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-dbg", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26825 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20124, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-devel", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26826 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20125, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-embedded", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26827 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20126, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-enchant", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26828 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20127, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-ffi", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26829 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20128, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-fpm", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26830 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20129, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-gd", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26831 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20130, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-gmp", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26832 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20131, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-intl", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26833 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20132, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-ldap", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26834 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20133, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-mbstring", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26835 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20134, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-mysqlnd", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26836 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20135, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-odbc", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26837 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20136, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-opcache", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26838 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20137, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pdo", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26839 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20138, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pgsql", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26840 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20139, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-process", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26841 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20140, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-snmp", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26842 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20141, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-soap", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26843 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20142, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-xml", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26844 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20143, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-xdebug3", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26845 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20144, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-rrd", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26846 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20145, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-zip", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26847 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20146, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-apcu", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26848 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20147, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-apcu-devel", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26849 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20148, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "php8.4-pecl-redis6", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26850 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20149, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "clevis-pin-trustee", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26851 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20150, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "ansible-collection-redhat-leapp", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26852 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 7, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20151, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "rhel-net-naming-sysattrs", ++"repository": "rhel9-BaseOS" ++} ++], ++"set_id": 26853 ++}, ++"initial_release": { ++"major_version": 9, ++"minor_version": 8, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [ ++{ ++"in_modulestream": null, ++"out_modulestream": null ++} ++], ++"out_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "net-naming-sysattrs", ++"repository": "rhel10-BaseOS" ++} ++], ++"set_id": 26854 ++}, ++"release": { ++"major_version": 10, ++"minor_version": 0, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"x86_64" ++], ++"id": 20152, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "go-fdo-client", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26855 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"x86_64" ++], ++"id": 20153, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "go-fdo-server", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26856 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20154, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "libdazzle-devel", ++"repository": "rhel9-CRB" ++} ++], ++"set_id": 26857 ++}, ++"initial_release": { ++"major_version": 9, ++"minor_version": 7, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 9, ++"minor_version": 8, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20155, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "libhandy-devel", ++"repository": "rhel9-CRB" ++} ++], ++"set_id": 26858 ++}, ++"initial_release": { ++"major_version": 9, ++"minor_version": 7, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 9, ++"minor_version": 8, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20156, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "trustee-kbs", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26859 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 4, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20157, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "keylime-agent-rust", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26860 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [ ++{ ++"in_modulestream": null, ++"out_modulestream": null ++} ++], ++"out_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "keylime-agent-rust", ++"repository": "rhel10-AppStream" ++}, ++{ ++"modulestreams": [ ++null ++], ++"name": "keylime-agent-rust-common", ++"repository": "rhel10-AppStream" ++}, ++{ ++"modulestreams": [ ++null ++], ++"name": "keylime-agent-rust-ima-emulator", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26861 ++}, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20158, ++"in_packageset": { ++"package": [ ++{ ++"modulestreams": [ ++null ++], ++"name": "keylime-agent-rust-push", ++"repository": "rhel10-AppStream" ++} ++], ++"set_id": 26862 ++}, ++"initial_release": { ++"major_version": 10, ++"minor_version": 1, ++"os_name": "RHEL" ++}, ++"modulestream_maps": [], ++"out_packageset": null, ++"release": { ++"major_version": 10, ++"minor_version": 2, ++"os_name": "RHEL" ++} ++}, ++{ ++"action": 0, ++"architectures": [ ++"aarch64", ++"ppc64le", ++"s390x", ++"x86_64" ++], ++"id": 20159, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "mariadb11.8-server-galera", +-"repository": "rhel10-AppStream" ++"name": "ruby", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26817 ++"set_id": 26863 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715325,29 +717174,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20116, ++"id": 20160, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "mariadb11.8-server-utils", +-"repository": "rhel10-AppStream" ++"name": "ruby-bundled-gems", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26818 ++"set_id": 26864 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715359,29 +717211,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20117, ++"id": 20161, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "mariadb11.8-test", +-"repository": "rhel10-AppStream" ++"name": "ruby-default-gems", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26819 ++"set_id": 26865 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715393,29 +717248,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20118, ++"id": 20162, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4", +-"repository": "rhel10-AppStream" ++"name": "ruby-devel", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26820 ++"set_id": 26866 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715427,29 +717285,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20119, ++"id": 20163, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-bcmath", +-"repository": "rhel10-AppStream" ++"name": "ruby-doc", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26821 ++"set_id": 26867 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715461,29 +717322,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20120, ++"id": 20164, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-cli", +-"repository": "rhel10-AppStream" ++"name": "rubygem-bigdecimal", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26822 ++"set_id": 26868 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715495,29 +717359,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20121, ++"id": 20165, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-common", +-"repository": "rhel10-AppStream" ++"name": "rubygem-bundler", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26823 ++"set_id": 26869 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715529,29 +717396,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20122, ++"id": 20166, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-dba", +-"repository": "rhel10-AppStream" ++"name": "rubygem-io-console", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26824 ++"set_id": 26870 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715563,29 +717433,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20123, ++"id": 20167, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-dbg", +-"repository": "rhel10-AppStream" ++"name": "rubygem-irb", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26825 ++"set_id": 26871 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715597,29 +717470,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20124, ++"id": 20168, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-devel", +-"repository": "rhel10-AppStream" ++"name": "rubygem-json", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26826 ++"set_id": 26872 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715631,29 +717507,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20125, ++"id": 20169, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-embedded", +-"repository": "rhel10-AppStream" ++"name": "rubygem-minitest", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26827 ++"set_id": 26873 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715665,29 +717544,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20126, ++"id": 20170, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-enchant", +-"repository": "rhel10-AppStream" ++"name": "rubygem-mysql2", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26828 ++"set_id": 26874 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715699,29 +717581,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20127, ++"id": 20171, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-ffi", +-"repository": "rhel10-AppStream" ++"name": "rubygem-mysql2-doc", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26829 ++"set_id": 26875 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715733,29 +717618,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20128, ++"id": 20172, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-fpm", +-"repository": "rhel10-AppStream" ++"name": "rubygem-pg", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26830 ++"set_id": 26876 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715767,29 +717655,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20129, ++"id": 20173, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-gd", +-"repository": "rhel10-AppStream" ++"name": "rubygem-pg-doc", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26831 ++"set_id": 26877 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715801,29 +717692,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20130, ++"id": 20174, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-gmp", +-"repository": "rhel10-AppStream" ++"name": "rubygem-power_assert", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26832 ++"set_id": 26878 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715835,29 +717729,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20131, ++"id": 20175, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-intl", +-"repository": "rhel10-AppStream" ++"name": "rubygem-psych", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26833 ++"set_id": 26879 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715869,29 +717766,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20132, ++"id": 20176, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-ldap", +-"repository": "rhel10-AppStream" ++"name": "rubygem-racc", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26834 ++"set_id": 26880 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715903,29 +717803,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20133, ++"id": 20177, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-mbstring", +-"repository": "rhel10-AppStream" ++"name": "rubygem-rake", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26835 ++"set_id": 26881 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715937,29 +717840,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20134, ++"id": 20178, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-mysqlnd", +-"repository": "rhel10-AppStream" ++"name": "rubygem-rbs", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26836 ++"set_id": 26882 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -715971,29 +717877,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20135, ++"id": 20179, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-odbc", +-"repository": "rhel10-AppStream" ++"name": "rubygem-rdoc", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26837 ++"set_id": 26883 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716005,29 +717914,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20136, ++"id": 20180, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-opcache", +-"repository": "rhel10-AppStream" ++"name": "rubygem-rexml", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26838 ++"set_id": 26884 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716039,29 +717951,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20137, ++"id": 20181, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-pdo", +-"repository": "rhel10-AppStream" ++"name": "rubygem-rss", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26839 ++"set_id": 26885 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716073,29 +717988,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20138, ++"id": 20182, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-pgsql", +-"repository": "rhel10-AppStream" ++"name": "rubygems", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26840 ++"set_id": 26886 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716107,29 +718025,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20139, ++"id": 20183, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-process", +-"repository": "rhel10-AppStream" ++"name": "rubygems-devel", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26841 ++"set_id": 26887 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716141,29 +718062,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20140, ++"id": 20184, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-snmp", +-"repository": "rhel10-AppStream" ++"name": "rubygem-test-unit", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26842 ++"set_id": 26888 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716175,29 +718099,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20141, ++"id": 20185, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-soap", +-"repository": "rhel10-AppStream" ++"name": "rubygem-typeprof", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26843 ++"set_id": 26889 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716209,29 +718136,32 @@ null + "s390x", + "x86_64" + ], +-"id": 20142, ++"id": 20186, + "in_packageset": { + "package": [ + { + "modulestreams": [ +-null ++{ ++"name": "ruby", ++"stream": "4.0" ++} + ], +-"name": "php8.4-xml", +-"repository": "rhel10-AppStream" ++"name": "ruby-libs", ++"repository": "rhel9-AppStream" + } + ], +-"set_id": 26844 ++"set_id": 26890 + }, + "initial_release": { +-"major_version": 10, +-"minor_version": 1, ++"major_version": 9, ++"minor_version": 7, + "os_name": "RHEL" + }, + "modulestream_maps": [], + "out_packageset": null, + "release": { +-"major_version": 10, +-"minor_version": 2, ++"major_version": 9, ++"minor_version": 8, + "os_name": "RHEL" + } + }, +@@ -716243,18 +718173,18 @@ null + "s390x", + "x86_64" + ], +-"id": 20143, ++"id": 20187, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-xdebug3", ++"name": "ruby4.0", + "repository": "rhel10-AppStream" + } + ], +-"set_id": 26845 ++"set_id": 26891 + }, + "initial_release": { + "major_version": 10, +@@ -716277,18 +718207,18 @@ null + "s390x", + "x86_64" + ], +-"id": 20144, ++"id": 20188, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-rrd", ++"name": "ruby4.0-devel", + "repository": "rhel10-AppStream" + } + ], +-"set_id": 26846 ++"set_id": 26892 + }, + "initial_release": { + "major_version": 10, +@@ -716311,18 +718241,18 @@ null + "s390x", + "x86_64" + ], +-"id": 20145, ++"id": 20189, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-zip", ++"name": "ruby4.0-rubygem-mysql2", + "repository": "rhel10-AppStream" + } + ], +-"set_id": 26847 ++"set_id": 26893 + }, + "initial_release": { + "major_version": 10, +@@ -716345,18 +718275,18 @@ null + "s390x", + "x86_64" + ], +-"id": 20146, ++"id": 20190, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-apcu", ++"name": "ruby4.0-rubygem-pg", + "repository": "rhel10-AppStream" + } + ], +-"set_id": 26848 ++"set_id": 26894 + }, + "initial_release": { + "major_version": 10, +@@ -716379,18 +718309,18 @@ null + "s390x", + "x86_64" + ], +-"id": 20147, ++"id": 20191, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-apcu-devel", +-"repository": "rhel10-AppStream" ++"name": "ruby4.0-doc", ++"repository": "rhel10-CRB" + } + ], +-"set_id": 26849 ++"set_id": 26895 + }, + "initial_release": { + "major_version": 10, +@@ -716409,22 +718339,20 @@ null + "action": 0, + "architectures": [ + "aarch64", +-"ppc64le", +-"s390x", + "x86_64" + ], +-"id": 20148, ++"id": 20192, + "in_packageset": { + "package": [ + { + "modulestreams": [ + null + ], +-"name": "php8.4-pecl-redis6", ++"name": "libkrun", + "repository": "rhel10-AppStream" + } + ], +-"set_id": 26850 ++"set_id": 26896 + }, + "initial_release": { + "major_version": 10, +diff --git a/etc/leapp/files/repomap.json b/etc/leapp/files/repomap.json +index a57a04e4..57ae0690 100644 +--- a/etc/leapp/files/repomap.json ++++ b/etc/leapp/files/repomap.json +@@ -1,8 +1,8 @@ + { +- "datetime": "202602061951Z", ++ "datetime": "202604161146Z", + "version_format": "1.3.0", + "provided_data_streams": [ +- "4.2" ++ "4.3" + ], + "mapping": [ + { +@@ -272,6 +272,12 @@ + "target": [ + "rhel10-rhui-microsoft-sap-ha" + ] ++ }, ++ { ++ "source": "rhel9-rhui-google-compute-engine", ++ "target": [ ++ "rhel10-rhui-google-compute-engine-leapp" ++ ] + } + ] + } +@@ -544,6 +550,24 @@ + "distro": "rhel", + "rhui": "alibaba" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-baseos-e4s-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "e4s", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-baseos-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, + { + "major_version": "10", + "repoid": "rhui-rhel-10-for-x86_64-baseos-rhui-rpms", +@@ -822,6 +846,24 @@ + "distro": "rhel", + "rhui": "alibaba" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-appstream-e4s-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "e4s", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-appstream-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, + { + "major_version": "10", + "repoid": "rhui-rhel-10-for-x86_64-appstream-rhui-rpms", +@@ -1041,6 +1083,15 @@ + "distro": "rhel", + "rhui": "alibaba" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-codeready-builder-for-rhel-10-x86_64-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, + { + "major_version": "10", + "repoid": "rhui-codeready-builder-for-rhel-10-x86_64-rhui-rpms", +@@ -1178,6 +1229,15 @@ + "distro": "rhel", + "rhui": "alibaba" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-supplementary-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, + { + "major_version": "10", + "repoid": "rhui-rhel-10-for-x86_64-supplementary-rhui-rpms", +@@ -1208,6 +1268,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-aarch64-rt-eus-rpms", ++ "arch": "aarch64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-aarch64-rt-rpms", +@@ -1216,6 +1284,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-ppc64le-rt-beta-rpms", ++ "arch": "ppc64le", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-ppc64le-rt-rpms", +@@ -1224,6 +1300,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-s390x-rt-beta-rpms", ++ "arch": "s390x", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-s390x-rt-rpms", +@@ -1248,6 +1332,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-x86_64-rt-eus-rpms", ++ "arch": "x86_64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-x86_64-rt-rpms", +@@ -1309,6 +1401,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-aarch64-nfv-eus-rpms", ++ "arch": "aarch64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-aarch64-nfv-rpms", +@@ -1317,6 +1417,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-ppc64le-nfv-beta-rpms", ++ "arch": "ppc64le", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-ppc64le-nfv-rpms", +@@ -1325,6 +1433,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-s390x-nfv-beta-rpms", ++ "arch": "s390x", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-s390x-nfv-rpms", +@@ -1349,6 +1465,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-x86_64-nfv-eus-rpms", ++ "arch": "x86_64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-x86_64-nfv-rpms", +@@ -1362,6 +1486,14 @@ + { + "pesid": "rhel10-SAP-NetWeaver", + "entries": [ ++ { ++ "major_version": "10", ++ "repoid": "rhel-10-for-aarch64-sap-netweaver-beta-rpms", ++ "arch": "aarch64", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "10", + "repoid": "rhel-10-for-aarch64-sap-netweaver-rpms", +@@ -1492,6 +1624,15 @@ + "channel": "ga", + "repo_type": "rpm", + "distro": "rhel" ++ }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-sap-netweaver-e4s-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "e4s", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" + } + ] + }, +@@ -1563,6 +1704,15 @@ + "channel": "ga", + "repo_type": "rpm", + "distro": "rhel" ++ }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-sap-solutions-e4s-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "e4s", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" + } + ] + }, +@@ -1779,6 +1929,15 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "10", ++ "repoid": "rhui-rhel-10-for-x86_64-highavailability-e4s-rhui-rpms", ++ "arch": "x86_64", ++ "channel": "e4s", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ }, + { + "major_version": "10", + "repoid": "rhui-rhel-10-for-x86_64-highavailability-rhui-rpms", +@@ -1977,6 +2136,34 @@ + } + ] + }, ++ { ++ "pesid": "rhel10-rhui-google-compute-engine", ++ "entries": [ ++ { ++ "major_version": "10", ++ "repoid": "google-compute-engine", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ } ++ ] ++ }, ++ { ++ "pesid": "rhel10-rhui-google-compute-engine-leapp", ++ "entries": [ ++ { ++ "major_version": "10", ++ "repoid": "google-compute-engine-el10-for-x86_64", ++ "arch": "x86_64", ++ "channel": "ga", ++ "repo_type": "rpm", ++ "distro": "rhel", ++ "rhui": "google" ++ } ++ ] ++ }, + { + "pesid": "rhel8-BaseOS", + "entries": [ +@@ -5067,6 +5254,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-aarch64-rt-eus-rpms", ++ "arch": "aarch64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-aarch64-rt-rpms", +@@ -5075,6 +5270,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-ppc64le-rt-beta-rpms", ++ "arch": "ppc64le", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-ppc64le-rt-rpms", +@@ -5083,6 +5286,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-s390x-rt-beta-rpms", ++ "arch": "s390x", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-s390x-rt-rpms", +@@ -5107,6 +5318,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-x86_64-rt-eus-rpms", ++ "arch": "x86_64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-x86_64-rt-rpms", +@@ -5168,6 +5387,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-aarch64-nfv-eus-rpms", ++ "arch": "aarch64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-aarch64-nfv-rpms", +@@ -5176,6 +5403,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-ppc64le-nfv-beta-rpms", ++ "arch": "ppc64le", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-ppc64le-nfv-rpms", +@@ -5184,6 +5419,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-s390x-nfv-beta-rpms", ++ "arch": "s390x", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-s390x-nfv-rpms", +@@ -5208,6 +5451,14 @@ + "repo_type": "rpm", + "distro": "rhel" + }, ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-x86_64-nfv-eus-rpms", ++ "arch": "x86_64", ++ "channel": "eus", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-x86_64-nfv-rpms", +@@ -5221,6 +5472,14 @@ + { + "pesid": "rhel9-SAP-NetWeaver", + "entries": [ ++ { ++ "major_version": "9", ++ "repoid": "rhel-9-for-aarch64-sap-netweaver-beta-rpms", ++ "arch": "aarch64", ++ "channel": "beta", ++ "repo_type": "rpm", ++ "distro": "rhel" ++ }, + { + "major_version": "9", + "repoid": "rhel-9-for-aarch64-sap-netweaver-rpms", +-- +2.53.0 + diff --git a/leapp-repository.spec b/leapp-repository.spec index f36845e..95613d7 100644 --- a/leapp-repository.spec +++ b/leapp-repository.spec @@ -52,7 +52,7 @@ py2_byte_compile "%1" "%2"} Name: leapp-repository Version: 0.24.0 -Release: 1%{?dist} +Release: 2%{?dist} Summary: Repositories for leapp License: ASL 2.0 @@ -66,6 +66,52 @@ BuildArch: noarch ### PATCHES HERE # Patch0001: filename.patch +Patch0001: 0001-Remove-legacy-overlay-solution-leftovers.patch +Patch0002: 0002-update-upgrade-paths-8.10-9.9-10.3.patch +Patch0003: 0003-Enable-logrotate.timer-during-8to9-IPU.patch +Patch0004: 0004-feat-net-naming-scheme-enable-by-default-on-CS-9to10.patch +Patch0005: 0005-Leapp_resume.service-Silence-AVC-SELinux-warnings.patch +Patch0006: 0006-Add-API-to-get-a-distro-report-name.patch +Patch0007: 0007-livemode-copy-upgrade-kernel-s-hmac-into-boot.patch +Patch0008: 0008-fix-livemode-make-live.dir-is-relative-to-device-roo.patch +Patch0009: 0009-fix-livemode-change-location-of-source-system-tree.patch +Patch0010: 0010-Respect-distro-names-in-reports.patch +Patch0011: 0011-checkblacklistca-Respect-distro-name-in-reports.patch +Patch0012: 0012-blsgrubcfgonppc64-Respect-distro-name-in-reports.patch +Patch0013: 0013-checkselinux-Respect-distro-name-in-report.patch +Patch0014: 0014-checkosrelease-Respect-distro-name-in-report.patch +Patch0015: 0015-rocecheck-Remove-outadated-check-for-source-version.patch +Patch0016: 0016-rocecheck-Respect-distro-name-in-report.patch +Patch0017: 0017-opensshpermitrootlogincheck-Remove-7to8-related-code.patch +Patch0018: 0018-opensshpermitrootlogincheck-Respect-target-distro-na.patch +Patch0019: 0019-checkifcfg_ifcfg-Respect-distro-name-in-report.patch +Patch0020: 0020-opensslproviders-Use-distro-name-in-the-leapp-commen.patch +Patch0021: 0021-opensslconfigcheck-Dont-make-the-recommendation-as-r.patch +Patch0022: 0022-checkmicroarchitecture-Respect-distro-name-in-report.patch +Patch0023: 0023-checkmemory-Respect-distro-name-in-reports.patch +Patch0024: 0024-targetuserspacecreator-Respect-distro-name-in-report.patch +Patch0025: 0025-checkdetecteddevicesanddirvers-Respect-distro-name-i.patch +Patch0026: 0026-reportleftoverpackages-Respect-distro-name-in-report.patch +Patch0027: 0027-fix-overlaygen-exclude-hugetlbfs-from-overlay-mounts.patch +Patch0028: 0028-biosdevname-Fix-check-of-naming-scheme-and-tests.patch +Patch0029: 0029-persistentnetnamesdisable-refactoring-fix-ethX-detec.patch +Patch0030: 0030-Fix-scan-of-net-interfaces-non-PCI-conflicting-broke.patch +Patch0031: 0031-persistentnetnamesconfig-Deprecate-legacy-functional.patch +Patch0032: 0032-persistentnetnamesdisable-Disable-net.ifnames-correc.patch +Patch0033: 0033-persistentnetnamesdisable-Mention-net.naming-scheme-.patch +Patch0034: 0034-fix-quoting-in-list-representation-of-commands.patch +Patch0035: 0035-fixup-fix-quoting-in-list-representation-of-commands.patch +Patch0036: 0036-pulseaudiocheck-Add-PulseAudio-config-check-for-RHEL.patch +Patch0037: 0037-fix-checkyumpluginsenabled-correctly-create-remediat.patch +Patch0038: 0038-fix-rhui-consider-source-clients-always-signed.patch +Patch0039: 0039-Ensure-that-greenboot-rpms-are-removed-during-IPU.patch +Patch0040: 0040-Regenerate-grub-config-during-8-9-conversions.patch +Patch0041: 0041-python-tests-deps-update-version-requirements-per-py.patch +Patch0042: 0042-Drop-dependency-on-mock.patch +Patch0043: 0043-remove-single-quoting-from-remediation-commands-1520.patch +Patch0044: 0044-Update-leapp-data-data-stream-4.3-CTC-1.patch + + %description %{summary} @@ -119,7 +165,7 @@ Requires: leapp-repository-dependencies = %{leapp_repo_deps} # IMPORTANT: this is capability provided by the leapp framework rpm. # Check that 'version' instead of the real framework rpm version. -Requires: leapp-framework >= 6.2 +Requires: leapp-framework >= 6.5 # Since we provide sub-commands for the leapp utility, we expect the leapp # tool to be installed as well. @@ -245,6 +291,51 @@ Requires: fapolicyd # APPLY PATCHES HERE # %%patch -P 0001 -p1 +%patch -P 0001 -p1 +%patch -P 0002 -p1 +%patch -P 0003 -p1 +%patch -P 0004 -p1 +%patch -P 0005 -p1 +%patch -P 0006 -p1 +%patch -P 0007 -p1 +%patch -P 0008 -p1 +%patch -P 0009 -p1 +%patch -P 0010 -p1 +%patch -P 0011 -p1 +%patch -P 0012 -p1 +%patch -P 0013 -p1 +%patch -P 0014 -p1 +%patch -P 0015 -p1 +%patch -P 0016 -p1 +%patch -P 0017 -p1 +%patch -P 0018 -p1 +%patch -P 0019 -p1 +%patch -P 0020 -p1 +%patch -P 0021 -p1 +%patch -P 0022 -p1 +%patch -P 0023 -p1 +%patch -P 0024 -p1 +%patch -P 0025 -p1 +%patch -P 0026 -p1 +%patch -P 0027 -p1 +%patch -P 0028 -p1 +%patch -P 0029 -p1 +%patch -P 0030 -p1 +%patch -P 0031 -p1 +%patch -P 0032 -p1 +%patch -P 0033 -p1 +%patch -P 0034 -p1 +%patch -P 0035 -p1 +%patch -P 0036 -p1 +%patch -P 0037 -p1 +%patch -P 0038 -p1 +%patch -P 0039 -p1 +%patch -P 0040 -p1 +%patch -P 0041 -p1 +%patch -P 0042 -p1 +%patch -P 0043 -p1 +%patch -P 0044 -p1 + %build cp -a leapp*deps*el%{next_major_ver}.noarch.rpm repos/system_upgrade/%{repo_shortname}/files/bundled-rpms/ @@ -340,6 +431,27 @@ fi %changelog +* Fri Apr 17 2026 Petr Stodulka - 0.24.0-2 +- Introduce new upgrade path 9.9 -> 10.3 +- Requires leapp-framework 6.5+ +- Configure the net.naming-scheme when upgrading CS 9 to 10 +- Fix scan of physical network interfaces and ethX detection +- Fix quoting in list representation of remediation commands +- Check PulseAudio configuration incompatible with PipeWire +- Consider RHUI source clients as signed by distribution vendor +- Ensure that greenboot packages are removed during the upgrade +- Fix AVC SELinux warnings caused by leapp execution +- Fix detection of network interfaces with biosdevname naming on Dell machines +- Fix failing upgrades with hugetlbfs file systems specified in FSTAB +- Fix the upgrade with LiveMode on systems with FIPS +- Introduce DISTRO_REPORT_NAMES in the distro library to provide unified names for linux distributions for the use in leapp reports +- Livemode: Fix the upgrade on systems where the generated live image is not in rootfs +- Modify keys for several reports that have been inconsistent between major releases. The keys are now independent of the used upgrade path +- Respect names of distributions used for the IPU in preupgrade reports +- Minor updates in reports +- Update leapp data files +- Resolves: RHEL-1771, RHEL-72140, RHEL-148291, RHEL-150278, RHEL-156902 + * Tue Feb 10 2026 Karolina Kula - 0.24.0-1 - Rebase to new upstream 0.24.0 - Introduce new IPU path 9.8 -> 10.2 diff --git a/plans/tier0.fmf b/plans/tier0.fmf index 1042877..4fd596c 100644 --- a/plans/tier0.fmf +++ b/plans/tier0.fmf @@ -5,12 +5,12 @@ summary: Internal Tier0 tests environment: - SOURCE_RELEASE: '9.8' - TARGET_RELEASE: '10.2' + SOURCE_RELEASE: '9.9' + TARGET_RELEASE: '10.3' context: - distro: rhel-9.8 - distro_target: rhel-10.2 + distro: rhel-9.9 + distro_target: rhel-10.3 adjust: enabled: false